NetworkManager-1.10.6-lp150.4.12.1<>,v]/=„DAP(O4`1mqB̀6&;}PTX}m7M?+-X ̷l1*VD^83 @ ?CFdtZ_7t'Bk/v%> 6hVĵo٩_O5u>h`aXʡ{Iɺl5_l?ۗ;h1'Pb}粂h\h:i̅{e$ki/I {Ig0>LI`?IPd % P -[ai `P%dk'k 'k (k *hk Bk BkD<kFSkHjHkJD KKLKSK(T8TI9UI:[{I=6>>?F@NBVF]GtkH kIkX 8 Y l Z [ \ k]"pk^.b1c2,d2e2f2l2u2kv4wAkxC@kyDzHpHHHHII ILCNetworkManager1.10.6lp150.4.12.1Network Link Manager and User ApplicationsNetworkManager attempts to keep an active network connection available at all times. The point of NetworkManager is to make networking configuration and setup as painless and automatic as possible. If using DHCP, NetworkManager is intended to replace default routes, obtain IP addresses from a DHCP server, and change name servers whenever it sees fit.]obs-arm-7bXopenSUSE Leap 15.0openSUSEGPL-2.0-or-laterhttp://bugs.opensuse.orgProductivity/Networking/Systemhttp://www.gnome.org/projects/NetworkManager/linuxaarch64 test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in NetworkManager.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in NetworkManager.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-NetworkManager-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-NetworkManager-update-$service-new-in-upgrade" fi done for service in NetworkManager.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in NetworkManager-dispatcher.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in NetworkManager-dispatcher.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-NetworkManager-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-NetworkManager-update-$service-new-in-upgrade" fi done for service in NetworkManager-dispatcher.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset NetworkManager.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in NetworkManager.service ; do if [ ! -e "/run/rpm-NetworkManager-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-NetworkManager-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in NetworkManager.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset NetworkManager-dispatcher.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in NetworkManager-dispatcher.service ; do if [ ! -e "/run/rpm-NetworkManager-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-NetworkManager-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in NetworkManager-dispatcher.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi # enable NetworkManager-dispatcher, it's a DBus enabled service systemctl enable NetworkManager-dispatcher.service # bnc#803058: # sysconfig creates this file while update from openSUSE < 12.3, # which were using the NETWORKMANAGER=yes/no sysconfig variable. # When it exists and NETWORKMANAGER were enabled, force enable to # ensure, the network.service alias link exists points to us. if [ -f /dev/.sysconfig/network/migrate_nm_variable ] ; then . /dev/.sysconfig/network/migrate_nm_variable if [ "X$NETWORKMANAGER" = "Xyes" ] ; then # In running system "--force enable" is sufficient to # create the network.service alias link regardless if # the network.service is masked or not. # While 12.2 -> 12.3 dist update, enable seems to be # unable to create the alias... no idea why. Kick it rm -f /etc/systemd/system/network.service /usr/bin/systemctl --system daemon-reload || : /usr/bin/systemctl --force enable NetworkManager.service || : # and create the alias when enable failed to make it. if [ ! -e /etc/systemd/system/network.service ] ; then ln -sf /usr/lib/systemd/system/NetworkManager.service \ /etc/systemd/system/network.service fi /usr/bin/systemctl --system daemon-reload || : fi rm -f /dev/.sysconfig/network/migrate_nm_variable fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable NetworkManager.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop NetworkManager.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable NetworkManager-dispatcher.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop NetworkManager-dispatcher.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart NetworkManager.service ) || : fi else # package uninstall for service in NetworkManager.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart NetworkManager-dispatcher.service ) || : fi else # package uninstall for service in NetworkManager-dispatcher.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi $ tP  @&]\!  h    (  *C v y /|p , u43 i joo:qU8Ƚ&C GV901 bV1 j"R*!AAAA큤큤A큤AA큤A큤A큤A]u]u]u]u]q]p]p]v]v]v]p]p]p]v]v]v]q]q]q]q]q]q]q]v]v]v]v]v]v]v]v]v]v]v]v]v]q]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]p]Z}ZMZMZyWlZy]1]Wl]p]p]p]p]p]p]p]p]p]p]p]p]p]p]q]uddeee5a8cfa630f6d0866203586f1ce836dff2ba50a062a0ac1cd4e92cf48625d4ac24338101aef3456e8432415e87bc7fd9e64dd2c65e740ad6305e1caf39f308d5aa65c197687eab702e26a7414b7fb0c079e3e63d259568ee0797c36dca27823763eb636c06e04024b7f889ff355e369583ab7a38d1eec11e3285c2b03d6aea42a8c25e962b4f16cb7fa557cdf7b315470c725b400d15ab90acab7988440c6a06323b760801d7f0f8f6cbc26284a356bd8f6b6c0f35255e1f7159a1d1f1edfcfe82cc23944b799779ceb4eedd3780d7d0ce07b658ec66b2006b0f6d3ab42fc58e02526c48085688d579b893595325e75a6d4981feb6d1265389258094917b711b3fbaa828f81dd9234e6185f5bf97c89a100a1c4036f9c7cbefc619fa761a666dd6b5893fdf22b5523022b23db7b3919ac3b016645f04fad2fb6a52c1edbdfaae0141f881203b471d1095dc78d0bec8774bdce6a6d1f5d16e3d10ec96d72e96d41ef54d4e8ad649e0000ee5f609922675a141b5810984e53119f643169c80b839a7889b25beebbfc33be00c8ae5d17c1a7afc00e39ff3bf8319d8e5226c3a5528961c57d62d5f59094ed93d0ea3c867abccbb77a000da7d899b13069564e8e070407e588c917bc8284fdda0cb16e94b3a8001dc44566d479afc2ca2b943feac78b40d0801024ea4776571e83e5a99b3248fb1169cd8d660863329e54e3907b23c588f5ed43b236b92937c5bb093560209ad094076393138ad605420fdbdef39171abba135828547e9bc6bf04e1e904b059ee9319e4febdb2cef533930a1bd79d31d18587b7ba5a1bdac2f133f841629a30250704f786753146587a8119e819b23144bdddf0d5dbf81df393cbd830bab7622beb6ecc2b95cd46254c81fd938b7318578bcf62439bf4de9eedf0d298b84564c0fea028db7921b8be9a3c7ba18275a3667f61fcf451d0167465d526c28e8cc0d0884ab58b8577e8fd5288adada48ae58207eadba9c46b1a77d605c372b8d9856bbc40638bad6d07768cf335dd07675f07d04600fdc20c32821c7f5c2afa8725b381502477d793865ed28595f01a4f04c5206090809aba255c8bcb86b511b11b382c449e2d66c6a251ab6fcb5041237eeeecd89a4014c4d4db43143f3625982b388e968942cc3c0f040f6fe37b2384ca14ae3d3c871c9dca348deb923437beb889df92730ef1344cc37af07f2a91a270a842cfee1f3fe298ac5b58e06fbb17c0cfe8e1d2f4d86db3a3bc08cb5dd0f4e55998c74e2fed169bd76e8617140e8841d0c693a6575e4c89094200b24b7b5c5a084e337d74c8a16b3d69feb381182fda7350d7e12e87940317ba4e08552b7543c609c39e28ada5443aa1ba6826365e8f56fbbaf1b24732c5c590a304628eba831ca7b9d10ce51970a542c7ace39cc2c485b75e680633eb07a5cf4ed1c3d9a2e0f9e177f52a2e1d19cc3d51a6fa5bf6735728692b42f963a495120c5a445647aa21c213dd245dcaf0fb0f385e0da7f9c7b2f7a5654d78e9da5bbb81e869df2747d5a56c7ef3b06ae49508cec0742748dbe4889db543fafe5d1c5813e9ac7c0c81f788533af1641d694ecfd2d3fe5ba8e5e861311721288ffa387a20aaa131e26c031f6c87c7bfcb9d60c7b5b951065e0f6bdeaca128bbfdedeca44594d018924aea6948a6be59f835c2fe2664632d441fc2597f773d2ca9b86f2a3b6b6cff94f762a9116d8348ce5e8da1236119c18bc2d6a77da410d1e44b01628b70c3bd368a0e087aaca6c8a3620ae32cf8d77550faa888753b068ea744b1457ad177cccac3d971255667bf28f96ac47b623afa23a0081d2a08efaa0b89cb52b7a64b6d7f7324b2754dc78e723d91ec347161383ef992102f61b16dbcf5019075338eb1c1b83c8f5116626f8764b77dc7e2cf82f0e1431b9cea9b4e53be223638700e3705eb9b6a42e2af26f2c627a80c6be8a7a99fbd54dfd1f2160abdfb750a7bc129de910c3e030181f79687441b6f72f8c35ff1c3972fddc6e5469d618242acaae91284fffd7d83a5b61b1d83f06b4aea412184c4c09e9a28ea03ea9d49caeab7d41010722e31bd7e17273db71940f1daa908efbbbbcbf7f3599311cb1a95b0cbe59cd498af04de26ae5034d2e19a96493890d142a0e7748dc43a82a74edf8b1e5eefa8f5e80a41af4d34f8c0720a7042bcda075b350e8021029a9e563acdca4de772716a1ff10afd3b59534f864df8f44bcffe6da92add51858d29deabf39684b736eb6409e2a26f853e10a449401f91273b9b7a89f3039709cb5181d5d64f9b30e4135a85469d535553db28a4ddb2311a02ccbe81d480fc2c2c0b6738472d53ce7a4be6f5d2a5fa2950f8be7aacecd41fee04e5547bb4ea0c8691a147a1ccd79ebc1bd5191141a042bf8131dc793eed5f9061844c3c37489100871fb74cd42434c5deda2097ad8b1a015ff7b0043007e3dedcde7cf035ff7794542911e787208efe60394a648d8da66cbd3a0261e71323d02ab99f81c9ce2b5839229181b6f1aef327bd675c8cf328cc246c444c128d9170aa77cf10955feccf6104eff320c81bb741973021d41dd1e3bfb6991e3096f0f4e13ca8aad4c980fa630ac5afe2e9b009fc0acbbcc9b91d9d4c0e039c46bb574a3afb1d4bbcb8b837eac62182d343ca041d067c2c08974571926f3b4daee85bd6ffb25d55dbc0581d5b60adfc2d813b3c493b7069d8b773d8bb9545cda4256afd75a24c26ba50e3377787b78a120a66fa1901a33cf00da686e7cf4c6db89758637c25b709114e91bed58b8812a8595c288e2b1903e101b90bbdc8ae1fc05fad3a2fb42ff6ed6f80aa9198b5ca26aeae5cd20c0a07de5463942ee08c87988a05de4171b3a6aadfcd5cd2f0503dce5cd5d0ba1137f08b283a228ad800da1a7ff05e2b0fdc93c8fc159f03d0a915d4cda24d62139ecab67b3ce0f13ef93f34163fcc773876fe17fddfc8dd12f73966e9c4846fb7ccaec4dcb956543eae8b1fa68dc2828914f44198e3519704593bda3a4dfe54eb937073e0e398bc1b5bc834e27826bb88a2bf0b89a1bc763a572d1ac85d2d1de080c1590ef70d5c14125f0fce665c3e2b0e79814bd945e3b42ba84d89f00651e89ddbc733c91865ab85a45361d7b59de23f768294fdf68f12bbcb9381d97ede1a801423fd973f80743960cfeebb4957f1829610a47ae11f9ff78cf2d238f5e0b46b45d0853e24dc4a678d6267dd1f6ebbe33c637ba39840c238531d7a900c54afad1928491a914b5360a384a251488cc61cb8d183df015ae3894634708f77cd9a71772862fa95e55dd12a9e06abd1b939393fdbac3c9d6c2de73c1a973ef142b99561ebc654ba6dffadac3c5d1ff9d988d05ceaca8012a2150f79e825d1d27354e13b21fb5347c0b2d2096396cbd9215b762b2355b928518d30db1ceb395700c46d15c6d967a0e1b333a6a3831141ea80e13f1fdf8369d4384a24a02e85338b6fbbd177e9c5e3d2812ac8995fee6f2ed452441de7d6175b0300c1fb63e49d9659a4f9a09747c320d51d3cf9dfde210de67b70862acf849890f6477b00dd2a5c944a24373abef834dd36e0a5e82237b0122e036d69081aed9cfaaf9ed045c73a1dbdb9b0b9db8747391334fc0fc9184980acd90b2dc04eb4fdda9f1464ccc73b0d73618f082d77a8be482b0ba965f8667123d7425eaf8ad077256ebcd36cc73b0d73618f082d77a8be482b0ba965f8667123d7425eaf8ad077256ebcd36cc73b0d73618f082d77a8be482b0ba965f8667123d7425eaf8ad077256ebcd36cc73b0d73618f082d77a8be482b0ba965f8667123d7425eaf8ad077256ebcd360766a8d3d5548a88028299ca021349aa7322b68fa982f38c65823d094560ee35407dc7a01341a8f9ea7332833295b5e285c2a516e4598488734018e67421705847381a148e58035f67d3d72a584e61fac459daed9ed498481bc653035aa7fb470766a8d3d5548a88028299ca021349aa7322b68fa982f38c65823d094560ee3593d6e19ff530f471896b9d77212a1a9239aacec6da0f93573603513db532bf69bb7fea0ab49dfaa32973b2b876fbb61c7b10c0b80f5b71339dc005be3f4786457bac3bcdaf7852a0447ec14cdd9e44a80fee23d35bbd9fc50bee64eb60064ce51dbfb151e50d77f8a9dd4f1a0e3a6f20b33feb328ac5425b91e51e28aab196c9nmtuinmtuinmtuiQrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootNetworkManager-1.10.6-lp150.4.12.1.src.rpmNetworkManagerNetworkManager(aarch-64)config(NetworkManager)dhcdbdlibnm-device-plugin-adsl.so()(64bit)libnm-device-plugin-bluetooth.so()(64bit)libnm-device-plugin-ovs.so()(64bit)libnm-device-plugin-team.so()(64bit)libnm-device-plugin-wifi.so()(64bit)libnm-device-plugin-wwan.so()(64bit)libnm-ppp-plugin.so()(64bit)libnm-settings-plugin-ibft.so()(64bit)libnm-wwan.so()(64bit)@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@      /bin/bash/bin/sh/bin/sh/bin/sh/bin/shNetworkManager-brandingconfig(NetworkManager)dhcp-clientiproute2iputilsld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libbluetooth.so.3()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libcurl.so.4()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgmodule-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libjansson.so.4()(64bit)libmm-glib.so.0()(64bit)libndp.so.0()(64bit)libnewt.so.0.52()(64bit)libnewt.so.0.52(NEWT_0.52)(64bit)libnewt.so.0.52(NEWT_0.52.13)(64bit)libnewt.so.0.52(NEWT_0.52.6)(64bit)libnewt.so.0.52(NEWT_0.52.9)(64bit)libnl-3.so.200()(64bit)libnl-3.so.200(libnl_3)(64bit)libnm-wwan.so()(64bit)libnm.so.0()(64bit)libnm.so.0(libnm_1_0_0)(64bit)libnm.so.0(libnm_1_10_0)(64bit)libnm.so.0(libnm_1_10_14)(64bit)libnm.so.0(libnm_1_10_2)(64bit)libnm.so.0(libnm_1_2_0)(64bit)libnm.so.0(libnm_1_4_0)(64bit)libnm.so.0(libnm_1_6_0)(64bit)libnm.so.0(libnm_1_8_0)(64bit)libnspr4.so()(64bit)libnss3.so()(64bit)libnss3.so(NSS_3.2)(64bit)libpolkit-agent-1.so.0()(64bit)libpolkit-gobject-1.so.0()(64bit)libpsl.so.5()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)libreadline.so.7()(64bit)libsmime3.so()(64bit)libsmime3.so(NSS_3.2)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libsystemd.so.0(LIBSYSTEMD_221)(64bit)libteamdctl.so.0()(64bit)libudev.so.1()(64bit)libudev.so.1(LIBUDEV_183)(64bit)libuuid.so.1()(64bit)libuuid.so.1(UUID_1.0)(64bit)mozilla-nssppprpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysconfig-netconfigsystemdsystemdsystemdsystemdwpa_supplicant1.10.6-lp150.4.12.12.4.73.0.4-14.6.0-14.0.4-14.0-15.2-10.80.50.6.44.14.1]y@\\\e\@\|\R@ZK@ZZkZZ@ZZH@ZxG@Zk@ZiZhu@Z8@Z+@Z!D@YY@YdY_wY^&@Y0Y.@YXQ@XBX6@XAXXXU(XU(XS@WSWށWu@W@W@W@W@W@W@WWL+@W@WV@VbVV@VVV @VzVTQ@U@UoU@UL@UL@UK@UJ@UT@TܕT}TTq@TTO@Ignaz Forster Jonathan Kang Jonathan Kang sckang@suse.comsckang@suse.comAntonio Larrosa sckang@suse.comsckang@suse.comdimstar@opensuse.orgdimstar@opensuse.orgfabian@ritter-vogt.deseife+obs@b1-systems.comdimstar@opensuse.orgsckang@suse.comdimstar@opensuse.orgbjorn.lie@gmail.comdimstar@opensuse.orgbjorn.lie@gmail.commgorse@suse.compavlix@pavlix.netyfjiang@suse.comsckang@suse.comzaitor@opensuse.orgsckang@suse.comzaitor@opensuse.orgdimstar@opensuse.orgsckang@suse.comtchvatal@suse.comtchvatal@suse.combholst@lusku.dedimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgdimstar@opensuse.orgzaitor@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgsckang@suse.comfcrozat@suse.comsckang@suse.comsckang@suse.combadshah400@gmail.comsckang@suse.combadshah400@gmail.comzaitor@opensuse.orgdimstar@opensuse.orgdamjanovic.ivo@gmail.comdimstar@opensuse.orgzaitor@opensuse.orgsimon@simotek.netdimstar@opensuse.orgbastianholst@gmx.deglin@suse.comdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgglin@suse.comdimstar@opensuse.orgdimstar@opensuse.orgbadshah400@gmail.comsfalken@opensuse.orgarvidjaar@gmail.comdimstar@opensuse.org- Modify nfs script: Only mount/unmount when the file type is nfs (bsc#1074074). (Backport of Factory revision 335, also fixes boo#1146935)- Add nm-add-CAP_SYS_ADMIN-permission.patch: Add CAP_SYS_ADMIN which netconfig needs to call setdomainname (bsc#1129587).- Add NetworkManager-CVE-2018-1000135.patch: Fix CVE-2018-1000135 (bsc#1086263, bgo#746422).- Add NetworkManager-make-nm-wait-online-follow-nm-service.patch: make enablement of n-m-wait-online.service follow n-m.service (boo#1130355, gh#NetworkManager/NetworkManager#76).- Modify NM-add-wifi-scan-polkit-rule.patch: Use polkit action "org.freedesktop.NetworkManager.wifi.scan" instead of "org.freedesktop.NetworkManager.wifi-scan" to sync with upstream (bsc#1128560).- Fix the connectivity value of devices which was set to LIMITED when the connectivity check fails. Now if the connectivity is being set to LIMITED but the device state is DISCONNECTED, then the value is coerced to NONE. Add patch submitted to upstream (boo#1103678, glfdo#NetworkManager/NetworkManager#138): * 0001-Coerce-connectivity-LIMITED-to-NONE-when-device-is-d.patch - Fix the global connectivity value which wasn't updated when a device was removed. Which is a problem if the device being removed is the one providing the connectivity. Add patch submitted to upstream (boo#1103678, glfdo#NetworkManager/NetworkManager#141): * 0001-Update-connectivity-value-on-device-removal.patch- Add NM-add-wifi-scan-polkit-rule.patch: Adding a new polkit action "org.freedesktop.NetworkManager.wifi-scan" so that distributions can add specific rule to allow Wi-Fi scans (bsc#1122262, glfo#NetworkManager/NetworkManager!68).- Add NM-look-at-all-rp-filter-value.patch: look at 'all' rp_filter value too to determine actual value (bsc#1084336, bgo#794689).- Unconditionally enable translation-update-upstream: on Tumbleweed, this results in a NOP and for Leap in SLE paid translations being used (boo#1086036).- Update to version 1.10.6: + ovs: fix compilation issue of OVS plugin and various fixes. + team: add support for team runner "random". + core: cleanup activation of device (rh#1537160). + dhcp: retry indefinitely to renew the lease (rh#1503587). + core: fix blocking autoconnect for no-secrets (bgo#794014). + libnm: mark async results as cancelled (bgo#794088). + Various bug fixes including possible crashes. + Updated translations. - Drop nm-preserve-agent-owned-secrets-on-connection-update.patch, NetworkManager-1.10.4-buildfixes.patch and nm-fix-autoconnect.patch: fixed upstream.- Add nm-fix-autoconnect.patch: Fix autoconnect with agent-owned secrets (bgo#794014, boo#1079672).- fix nfs dispatcher script (boo#1083831)- Modernize spec-file by calling spec-cleaner- Add nm-preserve-agent-owned-secrets-on-connection-update.patch: Backport upstream commit to preserve agent-owned secrets on connection update (bgo#793324, bsc#1082762).- Update to version 1.10.4: + Load jansson at runtime. This solves a clash with json-glib that caused a gnome-control-center crash, but also gets rid of a hard dependency. + Correct nmcli exit values after receiving a signal. + Fix libnm secret agent asynchronous initialization. + Add a default route for a modem even if it didn't sent a gateway. + Improve communication of DAD failures. + Remember device default metrics across daemon restarts. + Various bug fixes including possible crashes. + Updated translations. + Add NetworkManager-1.10.4-buildfixes.patch: Fix OVS compile errors (bgo#793183).- Replace sysconfig with sysconfig-netconfig BuildRequires and Requires, this is what we in reality need.- Update to version 1.10.2: + Added support for 'onlink' IPv4 routes attribute. + Wait longer for the carrier to come up after a MTU change. + Implemented abstraction for team connections that exposes team configuration items as distinct properties. + Added basic support for tc queueing disciplines and filters. + Introduced an Update2() D-Bus method to update connection settings with more flexibility. + Many bug fixes and improvements. - Changes from version 1.10.0: + NetworkManager includes now basic OpenVSwitch support, good enough to be capable of setting up simple OpenVSwitch configurations. + Added support for activating PPP connections on non-Ethernet interfaces. + It is now possible to authenticate to a Wi-Fi network using WPS (Wi-Fi Protected Setup). + Implemented support for Wi-Fi PMF (Protected Management Frames, 802.11w), which can be configured via the wifi-sec.pmf property. + Now the maximum rate of wireless access points supporting 802.11 is properly calculated and exposed on D-Bus. + Background scanning is now disabled for non-WPA-Enterprise Wi-Fi networks. + Added support for the Bluetooth NAP (Network Access Point) profile. + Added support for disabling connectivity checking via the D-Bus interface. + The internal DHCP client now understands the domain-search option. + Bridge connections support the group-forward-mask property. + NetworkManager can now configure multiple IPv6 default routes received through RA and each gets configured with the announced preference. + It is possible to specify the routing table for each static route. + Support specifying a explicit routing table for any non-static-route, including routes from DHCP, device-routes, IPv6 autoconf. + Device are left configured when a user sets them as unmanaged by NetworkManager. + New connection.auth-retry property to configure how often authentication is prompted before failing the configuration. + The platform code that handles synchronization with kernel status via netlink has been reworked and is more efficient. + Allowed the update of connections that have an associated ifcfg-rh routing rules file. + Non-UTF8 properties are now escaped when they are exported on D-Bus. + NetworkManager-wait-online.service now starts NetworkManager.service if needed. + The MAC address for bond connections can be changed in nmtui. + Fixed dependency problems when setting the MTU of VLAN and master devices. + The systemd-resolved DNS plugin properly handles the DNS priority setting. + Fixed setting a DHCP timeout greater than 60 seconds (dhclient). + Fixed some memory leaks. + Many other bug fixes and improvements. - Rebase networkmanager-obs-net.patch and nm-dont-overwrite-resolv-conf.patch. - Drop nm-disconnect-proxy-signals.patch and nm-vpn-remote-connection-disconnect-signals.patch: Fixed upstream.- Update to version 1.8.6: + Fix a daemon crash on permission check (bgo#787897). + Fix a daemon crash on VPN state change (bgo#787893). + Fix a nmcli crash in interactive mode's describe command (bgo#788104). + Fix termination of the nmcli interactive mode (rh#1517401). + Properly handle route metric of zero in keyfiles. + Add support for DSA switch devices (rh#1371289). + Fix a memory leak of connection D-Bus objects (rh#1461643). + A double close that could potentially race with the D-Bus thread reusing the same file descriptor (rh#1451236). + Connectivity check fixes (bgo#785281) (bgo#784629). + Fix the metered properties handling in libnm. + Avoid dropping agent secrets unnecessarily (bgo#789383). + Fix the asynchronous initialization of a secret agent in libnm. - Drop nm-disconnect-proxy-signals.patch and nm-vpn-remote-connection-disconnect-signals.patch: Fixed upstream. - Minor spec cleaning, tweak spec to silence a few rpm lint warnings. - Replace addFilter("dbus-policy-missing-allow") with addFilter("dbus-policy-allow-without-destination"), filter out the current rpmlint warning. - Add addFilter("suse-branding-unversioned-requires*") to rpmlintrc, we have this unversioned on purpose. - Add addFilter("systemd-service-without-service_add_post NetworkManager-wait-online.service") addFilter("systemd-service-without-service_add_pre NetworkManager-wait-online.service") addFilter("systemd-service-without-service_del_postun NetworkManager-wait-online.service") addFilter("systemd-service-without-service_del_preun NetworkManager-wait-online.service") to rpmlintrc, filter out warnings we do not care about nor want as we do not want to enable this service by default. - "Mark" %%{_sysconfdir}/dbus-1/system.d/org.freedesktop.NetworkManager.conf and %%config %{_sysconfdir}/dbus-1/system.d/nm-dispatcher.conf as config files in spec, silence rpmlint.- Add nm-disconnect-proxy-signals.patch: disconnect proxy signals when closing; fixes possible crash when opening the user panel (bgo#787897). - Add nm-vpn-remote-connection-disconnect-signals.patch: disconnect signal handlers when remote/vpn connections are disposed; fixes a gnome-control-center crash (bsc#1073472 bgo#787893).- Remove reference to deprecated and dropped ifcfg-suse plugin from configuration.- Switch to python3: + Replace BuildRequires python-gobject, python2-dbus-python with python3-gobject, python3-dbus-python. + Explictly set environment variable PYTHON as python3 in build time.- Modify nm-dont-overwrite-resolv-conf.patch: make netconfig call an atomic action, don't kill it after 2000ms (bsc#960153).- Update to version 1.8.4: + No longer install NetworkManager-wait-online.service in network-online.target.wants directory (rh#1455704). + Fix nmcli device connect wifi for APs that support both WPA-PSK and WPA-EAP (rh#1492064). + Fix crash unregistering object manager in libnm on restart of NetworkManager. + Improve handling externally managed slaves devices. + Don't reset MAC address of software devices to fake permanent address. + For dhclient use "timeout" option in configuration file, instead of the command line option which is only supported by downstream. + Perform the public-suffix check only for the hostname-derived domain. + Fix memory leak in connectivity check. + Better restore device managed state on rollback of checkpoint. + Skip addition of default-route if it already exists. + Bug fix detecting error condition when deleting route in platform. - Drop NM-dhcp-improve-parsing-interface-statement.patch: Fixed upstream.- Add NM-dhcp-improve-parsing-interface-statement.patch: Fix NM not writing DNS servers to /etc/resolv.conf (boo#1047004).- Update to version 1.8.2: + Fix bug blocking startup wrongly waiting for carrier. + Fix handling of non UTF-8 strings in libnm and fix non NUL terminated string. + Handle DNS priority for systemd-resolved DNS plugin. + Fix assuming master devices as they wait for slaves to activate. + Fix reading managed state from device state file. + Fix crash activating bluetooth or WWAN connection. + No longer add a direct route to the DHCP server. + Several bug fixes and improvements.- Call autogen.sh networkmanager-obs-net.patch touches the build system.- Add nm-dont-overwrite-resolv-conf.patch: Fix NetworkManager overwriting /etc/resolv.conf (bsc#960153, bsc#1021665).- Disable 6 of the tests that are failing on OBS runs * networkmanager-obs-net.patch- Version update to 1.8.0: * Default routes set by devices that failed connectivity checks are now penalized with a higher metric * nmcli is now able to produce output more friendly for machine parsing * The slaves available at the time a master connection is activated are enslaved in a stable order, making the automatic MAC address for Bonding devices more predictable. * Hostname management is now more flexibly configured * Support for additional route options (pref-src, src, tos, window, cwnd, initcwnd, initrwnd, mtu, lock-window, lock-cwnd, lock-initcwnd, lock-initrwnd, and lock-mtu). * Fixed detection of EAP-FAST support in wpa_supplicant * Support for handling PINs for PKCS#11 tokens as secrets * GSM and CDMA connections now have a MTU property * An option to disable selected TLS versions during EAP phase 1 authentication * The 802.1x authentication timeout is now configurable to allow a faster fallback to other connections * Persist managed state of device until reboot. This improves seamless take over of a previously managed device after restart of NetworkManager. * Better handle devices that are externally managed by somebody else by consistently generating an in-memory connection to reflect the external state. * Expose SRIOV capability of a device on D-Bus and support configuring the number of virtual functions via NetworkManager.conf. * Support matching networking devices via new "driver:" device spec in NetworkManager.conf. * Introduced support for creating and managing dummy links * The teaming devices now support setting a hardcoded MAC address * Settings of bonding devices can now be modified on-the-fly, without the need to reactivate a connection * The failures to activate a connection now communicate better error responses to nmcli * Reverse Path filtering is now disabled in multihoming configurations where it would interfere with legitimate network traffic * libcurl is used instead of libsoup for connectivity checking, resulting in a smaller dependency footprint * With DNS mode "rc-manager=symlink", don't write /etc/resolv.conf as a symlink if it already exists as a regular file. * Support attaching user-data in form of key-value pairs to connection profiles. * Fix accpeting fully qualified name for ipv4.dhcp-hostname setting. * Make NetworkManager more forgiving to failure to change the MAC address during scanning. - Wimax switches are completely removed - Added dependencies on packages with versions to ensure all features are properly detected, configure reports yes for most items now * add libcurl * add libpsl * add python-dbus test dep - Remove gudev and soup deps as per upstream changes - Enable testsuite - Add patch networkmanager-checks-po.patch: * Our patch added new .in file that needs to be excluded from translations- Replace nfs NetworkManager dispatcher script. Issues of the old nfs dispatcher script, fixed by this commit: + It only mounts NFS shares with auto-mount. In SUSE's default configuration, those are tried to be mounted at boot. Unfortunately, this would not work, when NetworkManager handles the connection later. The boot process stops at this point. + It unmounts everything on each "down" for any network interface, even if the NFS share is still connected to the computer via another network interface.- Update to version 1.6.2: + Fixed build warnings with GCC 7. + Multiple bug fixes in NetworkManager, nmcli and nm-online including several crashes.- Update to version 1.6.0: + No further changes since rc2 (1.5.91).- Update to version 1.5.91: + Bugs fixed: bgo#777402, rh#1406454, rh#1414186.- Update to version 1.5.90: + Avoid reading the permanent MAC address before the device is initialized by UDEV. This avoids a race where NetworkManager might detect the MAC address of the wrong interface. + Fixed race conditions when renaming interfaces, for example as done by UDEV for persistent interface naming. This could cause detecting devices as the wrong hardware type. + Added initial support for PKCS#11 tokens with 802.1x authentication. + The stable-addressing for MAC address randomization and RFC7217 IPv6 stable privacy addressing can now be more flexibly configured using dynamic randomization seeds in "connection.stable-id". + Added support for managing the MACsec links. Requires support in wpa_supplicant (version newer than 2.6). + When the master of Team, Bridge and Bond devices is specified as a connection UUID, the ifcfg-rh plugin now writes the master connection's interface name into the ifcfg file for improved compatibility with the legacy network service. + Improve handling of MTU by resetting the previous MTU when the device deactivates and reset the MTU to a defined value on activation. + Improve tracking of parent devices for dependend devices like ip-tunnels, MACVLAN, VETH, VLAN, and VXLAN. + Many bug fixes and improvements.- Update to version 1.5.3: + The cloned.mac-address property can now be used with Bond and Bridge devices. + The ifcfg parsing code has been reworked for better compatibility with actual shell variable files. + The ipv6.method=shared is now supported, utilizing DHCPv6 Prefix Delegation option to obtain prefixes for the interface. + nmtui now supports creating and editing IP tunnel connections. + The libnm client library now uses the D-Bus ObjectManager API that allows for quicker initialization of the clients. + nmtui now utilizes the asynchronous libnm client API to paralellize communication with the daemon, reducing the client startup time. + Ethernet devices now use "802-3.speed" and "802-3.duplex" properties to allow controlling overriding the negotiated link parameters. + Order in which IP addresses are configured is now preserved so that primary address is selected correctly. + The PPP manager can now be split into a separate package. + Details of the DNS information obtained from the connections is now exposed on the D-Bus and can be inspected with nmcli. + Added the support for DHCPV6_HOSTNAME and DHCPV6_SEND_HOSTNAME keys in ifcfg files that control "dhcp-hostname" and "dhcp-send-hostname" properties of the "ipv6" setting. - Add python-gobject BuildRequires: needed in order to build the settings documentation.- Update to version 1.5.2: + Introduced Vala bindings for libnm. + NetworkManager would now keep most connections up on shutdown (except Wi-Fi connections, VPN connections and other kinds that can't be assumed on startup) + The checkpoint/restore connection can now also remove new connections and disconnect devices that were activated since the checkpoint was taken. + The configuration is now read from /run/NetworkManager/conf.d as well. This is useful for handing over configuration discovered on system startup to NetworkManager. + New connection.autoconnect_retries property that allows fine-tuning the autoconnect behavior. + Support for configuration and discovery of Web Proxy settings with PacRunner service. + Support for systemd-resolved local DNS forwarder backend. + Fix emission of NM-style PropertiesChanged signals and deprecate them for PropertiesChanged on "org.freedesktop.DBus.Properties" interface. + Change the meaning of unset "cloned-mac-address" settings from "permanent" to "preserve". This changes the default value and affects existing connections during upgrade that did not explicitly configure cloned-mac-address. This has the effect that externally configured MAC addresses are preserved by default instead of setting the permanent address (bgo#770611).- Update to version 1.4.4: + Order in which IP addresses are configured is now preserved so that primary address is selected correctly. + Don't deconfigure devices we can take over on shutdown. Makes it possible to restart without connection disruption for most device types. + Avoid reading the permanent MAC address before the device is initialized by UDEV. This avoids a race where NetworkManager might detect the MAC address of the wrong interface. + Fixed race condition when renaming interfaces, for example as done by UDEV for persistent interface naming. This could cause detecting a Wi-Fi interface as ethernet. + Fixed a race condition in libnm that could cause a client hang if a last value from a property of object array type disappeared. + Fixed a possible nmcli hang on D-Bus object fetch failure. + Other fixes and improvements.- Update to version 1.4.2: + Fixed emission of NM-style PropertiesChanged signals and deprecated them for PropertiesChanged on "org.freedesktop.DBus.Properties" interface. + Fixed race condition in the communication between NetworkManager and the DHCP helper which caused loss of events. + Added workaround for failures in changing MAC address with some wireless drivers. + Improved bash autocompletion. + Restored check on JSON syntax when built with Jansson support. + Fixed a regression in the serialization of empty "cloned-mac-address" property in libnm. + Other fixes and improvements. - Drop NetworkManager-fix-broadcom-wifi.patch: Fixed upstream.- Add even more commits to really fix bgo#770456 to NetworkManager-fix-broadcom-wifi.patch.- Add NetworkManager-fix-broadcom-wifi.patch: Broadcom driver does not support the random mac addr introduced. This patch works around the problem (bgo#770456). - Conditionally apply translations-update-upstream BuildRequires and macro for non-openSUSE only.- Update to version 1.4.0: + The MAC address assigned to a device can now be set according to different policies: preserve, permanent, random, stable. + NetworkManager now waits for IPv6 DAD to terminate before completing the activation. + Added support for setting IPv6 tokenized interface identifiers through the 'ipv6.token' connection property. + Added a 'Reload' D-Bus method to reload configuration and reapply DNS configuration. + Added ability to create a configuration checkpoints and rolling back changes after a timeout. + NetworkManager now follows symlinks when accessing resolv.conf and rc-manager is set to 'file'. + Added support for oFono as modem manager. + The devices now exposes counters of transferred data. + The 'may-fail' property of ipv4 and ipv6 settings is now respected more accurately. + The timeout for requests of secrets to agents has been increased from 25 to 120 seconds. + Name servers passed to dnsmasq now specify an egress interface to avoid problems with multiple active connections. + Reverse DNS entries for IPv6 are now added to dnsmasq, and IPv4 reverse entries now honor the network prefix. + A new 'dns-priority' property of ipv4 and ipv6 settings can be used to tweak the order of servers in resolv.conf when multiple connections are active. + configure script accepts --enable-{address,undefined}-sanitizer options to build NetworkManager with GCC sanitizers. + The default resolv.conf manager can now be specified at build time using the --with-config-dns-rc-manager-default configure option. + NetworkManager is now compiled with --gc-sections to reduce executable size. + Added a new 'VPN_PLUGIN' logging domain. + It is now possible to change the configuration currently applied on a device with 'nmcli device modify' and 'nmcli device reapply'. + nmcli invoked without parameters shows an overview of the current network configuration. + The 'nmcli connection add' syntax has been extended and is now possible to pass properties (e.g. 'ipv4.dns') along with aliases. + nmtui now returns to initial menu after a sub-form exits. + Improved bash autocompletion for nmcli. + Now devices are disconnected before the system suspends, executing dispatcher scripts. This allows external applications to be notified of the change in connectivity. + Dispatcher scripts are now called also when connectivity status changes. + Many other fixes and improvements. - Pass --with-config-dns-rc-manager-default=netconfig to configure: ensure to use netconfig, which is SUSE's default. - Replace pgkconfig(systemd) BuildRequires with pkgconfig(libsystemd), following upstream. - Rebase systemd-network-config.patch.- Update to version 1.2.2: + The dnsmasq DNS management mode now uses D-Bus API of dnsmasq to make signal nameserver changes. + Hostname is now correctly read on Slackware. + IPv6 addresses for default wired connections now stay stable. + Reading portname on s390 systems on 4.4 kernels and newer has been corrected. + nmcli no longer warns about version mismatches. + Improved developer documentations. + Multiple minor bugfixes. + Updated translations.- Update to version 1.2.0: + Bugs fixed: bgo#764750, bgo#764955, bgo#764956, bgo#765225, rh#1325752. - Changes from version 1.1.94 (1.2-rc2): + Bugs fixed: bgo#764839, bgo#764690, rh#1324895. - Add post/postun scritlets for libnm0.- Update to version 1.1.93 (1.2-rc1): + Bugs fixed: bgo#761389, bgo#763236, bgo#764317, bgo#764332, bgo#764398, bgo#764402, bgo#764483, bgo#764606, rh#1299103. + Updated translations. - Changes from version 1.1.92: + Added an option to enable the old-fashioned /etc/resolv.conf handling (using a symlink). + NetworkManager now checks the connection data from client for validity and gracefully handles unknown properties in client. This improves interoperability between the server and clients of different versions. + The activation of a VLAN device with a virtual parent that is inactive now results in a parent being activated first. + The server name used with 802.1x authentication can now be constrained to a particular domain suffix (CVE-2006-7246). - Drop (presumably) no longer needed patches: + nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff + nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff- Update to version 1.1.91: + Added support for detecting duplicate IPv4 addresses, with a timeout configurable through the ipv4.dad-timeout connection property. + Fixed a race condition that could potentially lead to unauthorized access to connection secrets (CVE-2016-0764). + dnsmasq configuration for shared connections can now be extended by placing custom files in /etc/NetworkManager/dnsmasq-shared.d/. + Generic devices are no longer assumed unless explicitly requested by user. + The reorder-header VLAN flag setting is now honored; to keep backwards compatibility in behavior, an existing REORDER_HDR=0 ifcfg-rh key is ignored; the flag must be disabled with VLAN_FLAGS=NO_REORDER_HDR. + Fair amount of bugs was fixed and robustness was generally improved. - Rebase systemd-network-config.patch.- Update to version 1.1.90: + Added an option to enable use of random MAC addresses for Wi-Fi access point scanning (defaults to disabled). Controlled with 'wifi.mac-address-randomization' property (MAC_ADDRESS_RANDOMIZATION key in ifcfg files). + Wi-Fi scanning now utilizes wpa_supplicant's AP list. + Added support for Wi-Fi powersave, configured with POWERSAVE key in ifcfg files. + Added support for creation of more types of software devices: tun & tap, maxvlan, vxlan and ip tunnels (ipip, gre, sit, isatap, vti, ip6ip6, ipip6, ip6gre and vti6). + The software devices (bond, bridge, vlan, team, ...) can now be stacked arbitrarily. The nmcli interface for creating master-slave relationships has been significantly improved by the use of 'master' argument to all link types. + RFC7217 stable privacy addressing is now used by default to protect from address-based host tracking. The IPv6 addressing mode is configured with IPV6_ADDR_GEN_MODE key in ifcfg files. + Improved route management code to avoid clashes between conflicting routes in multiple connections. + Refactored platform code resulting in more robust interface to platform, less overhead and reduced memory footprint. + Improved interoperability with other network management tools. The externally created software devices are not managed until they're activated. + The Device instances now exist for all software connections and the platform devices are now only created when the device is activated. This makes it possible for connections with device of same name not to clash unless they're activated concurrently. The links are now not unnecessarily present unless the connection is active, avoiding pollution of the link name space. + NetworkManager now correctly manages connectivity in namespace-based containers such as LXC and Docker. + Support for configuring ethernet Wake-On-Lan has been added. + Added LLDP listener functionality and related CLI client commands. Enabled via LLDP option in ifcfg files. + CLI secret agent has been extended with support for VPN secrets. + The command line client now utilizes colors for its output. + The command line client now sorts the devices and properties for better clarity. + Numerous impovement to Bash command completion for nmcli. + NetworkManager relies on less external libraries. The use of dbus-glib has been replaced with gio's native D-Bus support and libnl-route is no longer used. + Dependency on avahi-autoipd has been dropped. Native IPv4 link-local addressing configuration based on systemd network library is now used instead. + Hostname is now managed via systemd-hostnamed on systemd-based systems. + Management of resolv.conf management can be changed at runtime, private resolv.conf is always written in /run. + DNS options in resolv.conf are now honored. + Updated version of systemd network library used for internal DHCP and IPv4 link-local support. + Support for event logging via audit subsystem has been added. + Support for native logging via systemd-journald has been added taking advantage of its structured logging. + Live reconfiguration in IP configuration after changing the settings without reactivation of the device with "nmcli device reapply" command and via D-Bus API. + The API for VPN plugins now supports multiple simultaneous connections. Most popular VPN plugins have been updated to support this functionality. + The libnm library now provides API to access VPN service definitions. + Fair amount of bugs was fixed and robustness was generally improved. + New DHCP_FQDN key in ifcfg files to configure the full FQDN to be sent to the DHCP servers. + Added multicast_snooping option to BRIDGING_OPTS ifcfg key. - Pass --enable-gtk-doc to configure: needed to have the man pages built. - Remove --enable-ifcfg-suse configure parameter: the ifcfg-suse plugin has been deprecated. - Add perl(YAML) BuildRequires: dependency to build the documentation. - Rebased systemd-network-config.patch. - Drop NetworkManager-geoclue-interaction.patch: the patch has side effects when geoclue itself is not installed. - Drop NetworkManager-openvpn-route-configuration.patch: no longer required. - Drop nm-ppp-manager-clear-ppp_watch_id.patch and nm-update-ip_iface-only-if-IP-interface-exists.patch: fixed upstream. - No longer recommend avahi-autoipd: the functionality is no longer needed. - Flip with_cacert_patch off (set to 0): patch needs rebase.- Modify nm-probe-radius-server-cert.patch: Make sure the "Apply" button in Wifi configuration page of gnome-control-center is clickable (bsc#985332).- Move provides NetworkManager(cacert-patch) to libnm-util2, to ensure gnome-control-center doesn't hard requires NetworkManager.- Update to version 1.0.12 (FATE#318572) - drop nm-core-fix-crash-during-Wi-Fi-rescan-by-emitting-NM_DE.patch contained in version 0.9.9.1. - Rebase NetworkManager-geoclue-interaction.patch - Rebase nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff - Rebase nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff - Rebase systemd-network-config.patch - Rebase nm-probe-radius-server-cert.patch- nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff rebased._ Update to version 1.0.12: + DHCP leases on software devices are now renewed when the computer is awoken from suspend. + Improved ifupdown plugin robustness and interoperability on Yocto and OpenEmbedded. + Fixed failed VPN activations when plugin supports interactive mode, but the VPN daemon does not. + Wi-Fi monitor interfaces are now ignored, not turned into managed mode. + AP and AdHoc mode connections with manual IP configuration are now able to autoconnect. + Broken device drivers (AWS ENI) that initially have invalid MAC addresses are now properly managed as soon as correct MAC address is set. + WWAN devices are unlocked a bit earlier so that supported IP versions can be queried. + The NetworkManager.service was ordered after network-pre.target and dbus.service. This ensures NetworkManager doesn't set up connectivity before firewall rules are in place and wouldn't exit before remote filesystems can be umounted ensuring orderly operation of systemd managed installations. + The netfilter rules used with shared IPv4 method are now removed on exit. + Ability to manage USB gadget drivers (UDC side) has beed added. + Infiniband transport mode change now takes place with the link set down because some drivers need that. + Race conditions that could disclose connection secrets to authenticated local users when changing ifcfg and keyfile connections have been fixed. This has security impact of low severity (CVE-2016-0764). + A handful of memory leak and crasher bugs of minor importance have been fixed. - Drop patches incorporated upstream: - NetworkManager-openvpn-route-configuration.patch. - nm-ppp-manager-clear-ppp_watch_id.patch. - nm-update-ip_iface-only-if-IP-interface-exists.patch. - Rebase systemd-network-config.patch for updated version.- nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff rebased.- Split out a NetworkManager-branding-upstream subpackage that installs the default upstream version of the /etc/NetworkManager/NetworkManager.conf file. - Add Requires: NetworkManager-branding to main package.- Add nm-ppp-manager-clear-ppp_watch_id.patch and nm-update-ip_iface-only-if-IP-interface-exists.patch: Patches from upstream git cherrypicked to stable branch from master.- Add NetworkManager-openvpn-route-configuration.patch: Fix routes not being applied when connecting to openVPN.- Add explicit pkgconfig(libteam) BuildRequires: force team connection support.- Update to version 1.0.10: + Added support for handling VPN secrets to nmtui and nmcli agent. + Fixed a regression that caused NetworkManager to ignore external deletion of a device with master. + Fixed glitches with older versions of glib (prior to 2.36.0). + Fixed build with most recent versions of libsoup. + Fixed busy retry loop on non-transient errors from wpa_supplicant. + Improvements to testing infrastructure. + Updated translations.- Update to version 1.0.8: + MTU indicated by a VPN gateway is now properly applied. + Fixed MSS setting when MTU changes. + The default route is properly restored on device disconnect. + Build with older toolchains has been fixed. + The team devices can now properly be enslaved to bridges. + Failed DHCP attempts for assumed connections are now retried after a timeout. + Default wired connection is now created after udev registers the device. + Support for Bluetooth DUN devices with Bluez 5 has been fixed. + The ipv6.ignore-auto-dns property is now properly honored making it possible to override automatically obtained name servers. + Invalid permanent MAC adddresses as reported by some devices are now ignored. + Device links reported by more recent versions of Linux kernel that reside in different network namespaces are no longer confused with links in the namespace NetworkManager runs in. + MAC address changes of VLANs enslaved to a bond are now properly propagated to the master device. + Fixed error handling for teaming devices with invalid configuration. + Wi-Fi AP list is now updated correctly after AP mode has been used. + Management of a device is not attempted until the device has been registered with udev. + The error handling for VPN secret agents is now significantly more robust. + Detection of s390 CTC devices now works properly. + A GATEWAY property in /etc/sysconfig/network now no longer affects non-static connections. + Added support for IPv6-only VPN connections. + The systemd service now uses HUP signal to reload configuration. + Change VLAN default flags to set REORDER_HDR for new connections. + nmtui is now able to ignore automatically configured routes. + Numerous bash shell autocompletion fixes for nmcli. + Allow setting IPv6 and PPP settings for GSM and CDMA connections via nmcli. + Added support for adding ADSL connections in nmcli. + Numerous crash fixes. + Updated translations. - Rebase NetworkManager-geoclue-interaction.patch.- Update to version 1.0.6: + Improved capture portal detection. + Default route through WiFi connection is now preferred to Mobile Broadband if both are available. + Expose a flag to determine whether a particular connection is metered via API and client tools. + Add support for locking connections to a channel within a particular band. + Add support for configuring Wake-on-LAN capabilitites. + Allow overriding the MTU for team device. + Usual pile of bug fixes and robustness improvements. - Rebase NetworkManager-geoclue-interaction.patch .- Toggle with_cacert_patch to 1: the patch has been rebased.- Change nfs dispatcher-script to be more reliable in mixed ip v4 v6 environments.- Rebase nm-probe-radius-server-cert.patch for 1.0.4 (bsc#938198).- Add explicit pkgconfig(udev) BuildRequires: we need it to define %{_udevdir}.- Update to version 1.0.4: + The MTU setting from an IPv6 neighbor discovery Router Advertisements is now ignored if applying it would result in invalid configuration. + Some configuration options can now be changed without restarting the daemon. Notably, this applies to 'dns', 'connectivity' and 'ignore-carrier' settings. + The connection activation was made more robust. If an active connection is reactivated, the device it's active on takes precedence. If an attempt is made to activate a connection on a different device than it is active on, the activation proceeds removing the connection from the active device. + The device specifiers in configuration files now support negation via 'except:' match. + Devices that only have IPv6 link-local address are no longer assumed to be connected. + nmcli now provides hints and tab-completion for enumeration properties. + If the IPv6 interface tokens are set they are honored when creating an interface identifier for IPv6 addressing. + NetworkManager now maintains correct routing configuration when multiple interfaces are connected to the same network. + The management of devices can now be controlled with udev rules. The veth devices as well as the virtual Ethernet devices of various virtualization tools (VMWare, VirtualBox, Parallels Workstation) are now ignored by default. + The IPv6 privacy extensions are now enabled by default and handling of the ip6-privacy sysctl has been improved. + Activating a Bond, Bridge or Team device can now optionally activate the slave connections as well. The behavior is controlled with 'connection.autoconnect-slaves' property. + The platform support code has been refactored, resulting in better scalability in large configurations. + Changes to network interfaces configuration done outside NetworkManager are now picked up and exposed to the user via NetworkManager API and tools. + A connection can now optionally leave externally configured default route in place instead of overriding it. The behavior is controlled with 'ipv4.never-default' and 'ipv6.never-default' properties. + Multiple crasher and memory leak bugs in the daemon were fixed. + Multiple bugs that could cause the client tools to hang or crash were fixed. + nmcli allows multiple devices for 'nmcli device disconnect/delete'. + Firewall zone is added to firewalld for device-based VPN connections too. - Toggle with_cacert_patch to 0: the Radius CA patch neeeds to be reworked. Wrap applying the patch into a with_cacert_patch condition, to make enabling/disabling a one-stop change.- Update to version 1.0.2: + Wi-Fi devices now indicate support for 2GHz and 5GHz frequencies. + "nmcli device" output now indicates physical port ID + New config items added to the 'ifcfg-rh' plugin: - IPV4_ROUTE_METRIC and IPV6_ROUTE_METRIC. - DEVTIMEOUT. - IPADDR and PREFIX are now supported for specifying address ranges of shared IPv4 connections. + Dispatcher scripts now get a CONNECTION_FILENAME variable with the path to the configuration file for the connection. + An example dispatcher script that is able to apply complex routing rules (such as setting up policy-based routing) for 'ifcfg-rh' connections was added to examples/dispatcher/. + 'mode' key of Bond device options property now accepts numeric values. + Connection attempts for devices without carrier on startup now wait for carrier to appear within a short timeout instead of failing immediately. This makes system startup more robust. + Bridge connectivity is now properly restored on resume from suspend. + The D-Bus name is acquired earlier during the daemon startup. This makes it possible for the systemd service manager to optimize the service startup so that services that require networking are activated sooner contributing to faster system start up time. + A lot of memory leak problems were fixed, resulting in reduced memory usage. Many of them were discovered as a result of improvements in use of Valgrind in the testing infrastructure. + Management of 'teamd' daemon instances for Team devices is now more robust. + The 'dnsmasq' daemon respawns when it terminates and it is configured for management of DNS resolver configuration. + Hostnames that are not fully qualified are no longer sent to a DHCPv6 server for a dynamic DNS update. + Connection UUIDs are now checked for uniqueness when connection configurations are read. + Receipt of a NDP Router Advertisement can no longer lower the IPv6 hop limit (CVE-2015-2924). + Many other bugs were fixed. + Updated translations.- Add NetworkManager(cacert-patch) provides: to be toggled to 0 whenever we disable nm-probe-radius-server-cert.patch. Other packages that consume the ABI introduced by this patch can specify this as a requirement.- Reabse nm-probe-radius-server-cert.patch- Add rp-pppoe BuildRequires, so configure can autodetect the path to the pppoe binary. - Recommend rp-pppoe: the program is needed for NetworkManager to be able to initiate PPPoE connections (commonly used by ADSL providers). It is not strictly required to operate NM in most setups, thus only recommended (boo#903553).- Update to version 1.0: + A new 'libnm' GObject-based client library to replace libnm-util/libnm-glib: - IP address, IP route, hardware address, and other properties are now represented as strings. - Based on GIO's GDBus bindings instead of dbus-glib. - Uses modern GObject APIs including GAsyncResult and GVariant. - See https://wiki.gnome.org/Projects/NetworkManager/libnm. + Devices and VPN connections now have individual default routes. Priorities are handled through configurable route metrics. + nmcli now supports password requests and PolicyKit authorizations. + A faster, lighter-weight (though less capable) internal DHCP client has been added and may be selected with the "dhcp=internal" option. It supports fewer DHCP options and does not yet support DHCPv6. + A new 'configure-and-quit=yes' option has been added for environments with less dynamic network configuration. + When running on 3.17 and later kernels, NetworkManager handles IPv6LL address assignment to ensure that IPv6 connectivity is not enabled until intentionally configured by the user. + NetworkManager no longer causes the nl80211 kernel module to be loaded on systems with no Wi-Fi devices. + Bluetooth DUN support now works with Bluez 5.x. + VPN connections can now persist across link changes and suspend/resume if their VPN plugin supports this feature. + A new 'ibft' settings plugin has been added to support firmware-based iBFT/iSCSI configurations. This functionality has been moved to 'ibft' from the 'ifcfg-rh' plugin. + IPv6 router advertisement MTUs are now respected. + NetworkManager no longer requires polkit libraries at runtime when Polkit support is enabled, and Polkit can be disabled at build time too. + Automatically created connections are now deleted when their device goes away. + 'nmcli dev connect' now attemts to create a connection if none exists. + Manually configured static IPv6 configuration is kept even if SLAAC fails. + Manpages for the 'keyfile' and 'ifcfg-rh' plugins now describe their configuration syntax and available options. + WWAN connections now support IPv6 if the modem and provider support IPv6. + Software devices (bridge, bond, team, etc) can now be deleted from the D-Bus API or with nmcli. + The manpages, documentation, and API annotations have received many cleanups. + Externally created virtual interfaces are no longer managed by NetworkManager until they are set "up" or activated via nmcli. - Disable nm-probe-radius-server-cert.patch for now: needs rebase. - Drop 0001-core-don-t-auto-launch-logind-bgo-741572.patch and NetworkManager-dhcpv6.patch: fixed upstream. - Split out new subpackage typelib-1_0-NM-1_0 and libnm0. - Require typelib-1_0-NM-1_0 and libnm0 by the -devel package. - Add pkgconfig(bluez) BuildRequires. - Replace pkgconfig(libsystemd-login) BuildRequires with pkgconfig(libsystemd) and pkgconfig(polkit-gobject-1) with pkgconfig(polkit-agent-1), following upstream.- Update to version 0.9.10.1: + Kernel 'cache' routes (such as those added by IPv6 operations) are ignored, preventing unwanted CPU usage. + Vala bindings for libnm-glib async methods have been added. + Some interactions with external OpenVPN daemon default routes have been fixed. + Fixed usage of libnm-glib connectivity checking from garbage-collected languages. + An unusual delay acquiring a DHCP lease with dhcpcd has been fixed. + A libnm-glib crash has been fixed when multiple NMClients are created. + A failure to pass certificate blobs to wpa_supplicant has been fixed. + A failure to send the inner private key password to wpa_supplicant has been fixed. + nmcli now returns earlier when activating master interfaces. + nmtui password fields now correctly display the password. + The IPv6 hop limit is no longer mistakenly set to 0 in some cases. + Some DHCPv6 failures are no longer fatal. + Handling of DHCP 'nak' and 'expire' states has been fixed in some cases. + WiFi band locking has been fixed. + Support for Bluetooth DUN with Bluez5 has returned. + Non-local users can now control networking after authenticating with PolicyKit. + Externally added routes no longer have their metrics overwritten. + Some child interfaces (eg VPN or WWAN) are no longer deconfigured when recognized. + Support for the PrimaryConnection D-Bus property has been backported. + IPv6 RDNSS/DNSSL forced expiration is now handled properly. + An invalid route to the DHCP server is no longer added in some configurations. + A crash when external master/slave changes were made has been fixed. + Various nmtui bugs for slaves, WiFi, and IP address buttons have been fixed. + DHCP no longer fails due to SIGPIPE when the systemd journal is restarted. + Unmanaged slaves are now updated correctly when they disappear. + Cooperation with external team interfaces has been fixed. + Bridge STP property ranges are now properly checked. + Manager state is now properly updated on resume. + Slave interfaces are no longer released on exit. + Static IPv6 configuration is now added before SLAAC is started. + Allow shared connections to be started without a carrier. + A crash when disconnecting older Nokia phones has been fixed. - Drop patches incorporated upstream: + 0001-core-don-t-auto-launch-logind-bgo-741572.patch. + NetworkManager-dhcpv6.patch.- Add NetworkManager-dhcpv6.patch: dhcp: let dhclient handle requesting the 'server-id' option (boo#912315).- Add 0001-core-don-t-auto-launch-logind-bgo-741572.patch: do not trigger logind start on system startup to avoid deadlock (boo#905639).- Handle NetworkManager-dispatcher.service using the systemd macros. - Enable NetworkManager-dispatcher.service in %post: as this is a dbus service, the 'systemd unit' must be enabled in order to be fired up./bin/sh/bin/sh/bin/sh/bin/shdhcdbdobs-arm-7 1570810280  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^^^^bcdbfghijk1.10.6-lp150.4.12.11.10.6-lp150.4.12.11.10.6-lp150.4.12.11.141.14 NetworkManagerVPNdispatcher.dnfssystem-connectionsnm-dispatcher.conforg.freedesktop.NetworkManager.confnm-onlinenmclinmtuinmtui-connectnmtui-editnmtui-hostnamenm-dhcp-helpernm-dispatchernm-iface-helperNetworkManager-dispatcher.serviceNetworkManager-wait-online.serviceNetworkManager.serviceNetworkManager.service.dNetworkManager-ovs.conf84-nm-drivers.rules85-nm-unmanaged.rulesNetworkManagerlibnm-device-plugin-adsl.solibnm-device-plugin-bluetooth.solibnm-device-plugin-ovs.solibnm-device-plugin-team.solibnm-device-plugin-wifi.solibnm-device-plugin-wwan.solibnm-ppp-plugin.solibnm-settings-plugin-ibft.solibnm-wwan.so2.4.7nm-pppd-plugin.soNetworkManagernmcliorg.freedesktop.NetworkManager.AccessPoint.xmlorg.freedesktop.NetworkManager.AgentManager.xmlorg.freedesktop.NetworkManager.Checkpoint.xmlorg.freedesktop.NetworkManager.Connection.Active.xmlorg.freedesktop.NetworkManager.DHCP4Config.xmlorg.freedesktop.NetworkManager.DHCP6Config.xmlorg.freedesktop.NetworkManager.Device.Adsl.xmlorg.freedesktop.NetworkManager.Device.Bluetooth.xmlorg.freedesktop.NetworkManager.Device.Bond.xmlorg.freedesktop.NetworkManager.Device.Bridge.xmlorg.freedesktop.NetworkManager.Device.Dummy.xmlorg.freedesktop.NetworkManager.Device.Generic.xmlorg.freedesktop.NetworkManager.Device.IPTunnel.xmlorg.freedesktop.NetworkManager.Device.Infiniband.xmlorg.freedesktop.NetworkManager.Device.Macsec.xmlorg.freedesktop.NetworkManager.Device.Macvlan.xmlorg.freedesktop.NetworkManager.Device.Modem.xmlorg.freedesktop.NetworkManager.Device.OlpcMesh.xmlorg.freedesktop.NetworkManager.Device.OvsBridge.xmlorg.freedesktop.NetworkManager.Device.OvsInterface.xmlorg.freedesktop.NetworkManager.Device.OvsPort.xmlorg.freedesktop.NetworkManager.Device.Ppp.xmlorg.freedesktop.NetworkManager.Device.Statistics.xmlorg.freedesktop.NetworkManager.Device.Team.xmlorg.freedesktop.NetworkManager.Device.Tun.xmlorg.freedesktop.NetworkManager.Device.Veth.xmlorg.freedesktop.NetworkManager.Device.Vlan.xmlorg.freedesktop.NetworkManager.Device.Vxlan.xmlorg.freedesktop.NetworkManager.Device.WiMax.xmlorg.freedesktop.NetworkManager.Device.Wired.xmlorg.freedesktop.NetworkManager.Device.Wireless.xmlorg.freedesktop.NetworkManager.Device.xmlorg.freedesktop.NetworkManager.DnsManager.xmlorg.freedesktop.NetworkManager.IP4Config.xmlorg.freedesktop.NetworkManager.IP6Config.xmlorg.freedesktop.NetworkManager.PPP.xmlorg.freedesktop.NetworkManager.SecretAgent.xmlorg.freedesktop.NetworkManager.Settings.Connection.xmlorg.freedesktop.NetworkManager.Settings.xmlorg.freedesktop.NetworkManager.VPN.Connection.xmlorg.freedesktop.NetworkManager.VPN.Plugin.xmlorg.freedesktop.NetworkManager.WiMax.Nsp.xmlorg.freedesktop.NetworkManager.xmlorg.freedesktop.nm_dispatcher.serviceNetworkManagerAUTHORSCONTRIBUTINGChangeLogNEWSREADMETODOserver.confNetworkManagerCOPYINGnm-online.1.gznmcli.1.gznmtui-connect.1.gznmtui-edit.1.gznmtui-hostname.1.gznmtui.1.gzNetworkManager.conf.5.gznm-settings-keyfile.5.gznm-settings.5.gznm-system-settings.conf.5.gznm-openvswitch.7.gznmcli-examples.7.gzNetworkManager.8.gzorg.freedesktop.NetworkManager.policyNetworkManagerNetworkManager/etc//etc/NetworkManager//etc/NetworkManager/dispatcher.d//etc/dbus-1/system.d//usr/bin//usr/lib//usr/lib/systemd/system//usr/lib/systemd/system/NetworkManager.service.d//usr/lib/udev/rules.d//usr/lib64//usr/lib64/NetworkManager//usr/lib64/pppd//usr/lib64/pppd/2.4.7//usr/sbin//usr/share/bash-completion/completions//usr/share/dbus-1/interfaces//usr/share/dbus-1/system-services//usr/share/doc/packages//usr/share/doc/packages/NetworkManager//usr/share/licenses//usr/share/licenses/NetworkManager//usr/share/man/man1//usr/share/man/man5//usr/share/man/man7//usr/share/man/man8//usr/share/polkit-1/actions//var/lib//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:11245/openSUSE_Leap_15.0_Update_ports/22ce023832ac54b9989839e7d84708d5-NetworkManager.openSUSE_Leap_15.0_Updatedrpmxz5aarch64-suse-linux   directoryBourne-Again shell script, ASCII text executableexported SGML document, ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=264d5e1edfa09b2aa27d813f31dcf737d87fa594, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=873012f3499305d1917242b1a20a976767cfc6ab, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=bd3363b238fd6fcc60a96350b2ac409cea711b4a, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=9caecca2d3b008dc403dc06879b5dc19ae171c6a, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=53026f99ec2b6547d4b9de3a1ff5c6acc2107000, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=50c968f4bb737d3c390296d979efef90ec92a1f4, strippedASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f69e0ee300010e944d0cb928e34859658b45ea1b, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8453b91f7716148ea5a4c5b6181da35512ba22f9, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2e0296911c743a38f34de511fee25da9a230cd24, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=77a24251e9bdced18fd9133e89f9888b43284e93, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=cda267820a14a146cf2a1f9508b6a88539bf026d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=59986c833eb9693ed6035245af2746c6c0b63bda, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d87a304b871fee5dce014bfb0862c2c4cdfa93b4, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1f7d7969f89001808b981f916e7e26846e87f371, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d8c9fb97650643ba35e61225845da40d254ec70d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8a64ec8c881f7ecdea252def8db97d184f900dd8, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-, for GNU/Linux 3.7.0, BuildID[sha1]=e5b1e39f4835ae152a12b583cc57e0ee9d4b83f2, strippedXML 1.0 document, ASCII textXML 1.0 document, ASCII text, with very long linestroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)XML 1.0 document, UTF-8 Unicode textempty !5=Hcjv    RR#R RR"RRRR1R R R R2RRR%R(R*R$R&R'R)R#R"R3R.R/RRRR1R R R R2RRR*R)R'R#RRRRR"RRRRR1R R R RRRRR1R R R2R R#RR"RRRR1R R RR R5R-R2R7R8R;R RRRV]w94s {"C~T Sur<;\{ԴHH_` 'bf1I8Лp+sx"vQ>De@Qؐ_:0+d1jS;Q HzϾ8*1NwԻm7[Vrc)@)=jOXQqBNqܙD"<)e:T)._ib>g9AB^L!Pnə<{ےS,ǍLvVhVjOZސ}hx-K <(T53sx C}X-yBfT P=x0-jCcۉXbhh]-*z(~GAN2S8?=5'IC6=SScKq-eȚ:i!)CRQOLSmSkT i֪ 0:l{7Ot8jO\>-n>b?V<§W5ƦB&yRm|9q.vB M 1 UyvjYΗ;bBr'(7!^̲J*C\E-%lB?0S~%xŌGt#/lI\.Z=PrBmȰt4%gd;Kԧ:rL=dĘC,owDb0(}HBd_!fQT?f b"=7D-r x!s7n8ADutOww>6VDC/"mtRήs&C>ͼmiH, "[wj_Z(&!ϟ5{b~B)ɻ]Ra_M%{q{)"CZ `w ĨplRۅz*vdnXwH,(TtB |pD}lMv/zL#v8QO;qކF\%,MTϐU  3 [G]$,n(1Fa̋ep"Cc' HZ. wla:3r$Ab TS7s G?YRt+.EƮ.GNEi@U]B6-KB3|s%Pa*qV!DPV a&R1u'($|&߼Ȼd^\hay{-n 7>߆eXYrv[w$bHT@ 1zGY={2#`рz)PlHtoMĈc2U4S)QvC4f(XE$PF;*emhdL@ր:l7q¿ءQ˔hrZSMՅZtϚTWq1);$ꯞf"B­rç>c>!?u9 6Q>:= z,);Ǭ91#?d"y]K _El +o[H*[ "6dK26t3pOIk6p[b4ͶZٽ,r,}$ss41Pv[MCic> aWBJv!K=~"A$^U; J/H: o]6Tl[&v^Dzh:c#m1uuL{I 8W{0pF2Y4ia-#R4DCWmIB094B̛.lv0%(  "C_OT$bݞxYЌL p9'u[65x3IޢzqĀDvWM= )> ubt\M-h3c/s *ۦ9tv<>Fc厵-g\T+lo"U y+|TY8<0weYô?kie3jslK'bL쇊bg:`n+8l3 @8b!V*B:qE QI0}BvRP0mtFm8 G0C & ׀Ӏ\))?XiPqe.Yc ԍ:ALvגI4?P4.|}-D㊬ӓz68%4B_rSkSfb+bМخ}X#ޣT Hw !K .Jp$sފO47͋Afa y/[[D.܍.L%U&x4ſLPS4D„6v MFJJY@DDAV{=*'a?|4J=:>=x|>f~(?i eS-|MJ(\AA%%C[`ᇩ+~[&nb`%űj+Ւ}-+~e tQ|vDu}y*aoDD4{)_BXMc*c.ciL02m9BgTSaAצE) f [7崪s`n벏H0ߤ>Ϩb_co tG`[Yys#C~!Jex' >& T$غ-GQ !йTDorj["'fC'*˧T|t*6K]rM?6$|?̲GbO4R|:P(̀ὴSMK. zFlU*tklAtg\ |A:dHm27R Л_=+!8*OvČyir7+,eCUUEMtSwyr 3$A #h^C}\ يu7P?WC.0Yy " e¬1,اd_-3Օ&L|: maS%%lBǼH 99d ǥL/*;c+}A\&RAt=~ڟNNJ >?*KH>6&⿠O1u)Vc9-P}dMH{_gs2 KNSb2 :wd ?.[mD,E+QMS`!M`5,z bQ>$oʝ#nK`9;kaݥҕ<lαj"C<~?<@g|9a`7hMUK>'OAX/0;B ")E[#ʲDJtL8m}j˞{$b2-h-/jUBf˩ClQ2* l\PnUs5 RH\N͹.8qqRTPl5~O0ySJ Qq[yU dPJlQYVJMԑi0p%/?$o:;[d͸HjQ߬nEj.Tw.zA0^xW}}+`ZL;@׺ڌDH!7,eb~Y@d^jR&um!QoRwun4.rޑb툧bjÞ>%Gu7;ENM2 Om63#1H>(o^$Jؐ8 Oy\D5S;]}*TVR4.UYO: wT瀘l8S3'U~-7Hhޝ>A޼rJy/ m5+7ܬw=bQ1qA SJWc[2ImAKjX} 3ݢG`d-2==I8/p0Z#H[jM]LfQ;$8~[\4~%aT]G ШΪ)6Ɩw:mt!lC粄"Q6-9 u) !r_@K=iBnMldک< &,`Bpj~y'aHUa;)ł͟~!GJiʙ˼iC毗 Ew4ހD+np:n w#<(yb3*u+툻ic..DU]=^T+ʾHSA*5DÿdFny٬M̸g&#qFHF'P%&<ם F`NB{Eీf(REBTDx=z{|;j /Y9DPk/V5%}*ʸ55n0\ؽ Z'B]Mň! ?fD5- $5\ڙ4J`0d( ̳R{cx_(o9a[+RWBH*m(\F>H6 g߆ s\ȳRjI ـlo!C ;<RҴR- Rk=m[:g|fYԘ6ڱC_Ыc3W\}o4~m/I~]VJ  }#?N}8Y^ZWE8PAez9j.1ʟN_ؐ`vRB02_&~A܉\yX"T)Zhɍ`kZ|J`f8C(A@k`εZIa%PӫZRF4N+RjT%I~ǁZx6k:$6N(+(ֶE櫱y3W3#'|a(]SŘdbLh >t[5nĖoϸd( =natd];I?W[qV,㤱ZlR莕24$'0 ZyP Ӻ7 LۚieDاT@d]7Yۊ3 J) SVB{5 3J/⡰]MאY=kϓ0VFjxw>±U 1Z.-ZVI/Y.;er  NNAc"QMм+i| Ӄdyޓ2]d7niLqz/aHr";pgL%tLz(%_ޞXV i'#p xfeIx m 3ܤJX%hW"c=EڗTdlSݞq2Y C1Ry$ۘqnrIxa5+-˦t^v9^b< $1|+*WOռS '\Z\0i E5)`FsҶÑJ> ,[=x 26uAoN/O/ iT'r`dV~dl}`=} Ɔn+Vzov&xp)&WtKpS4%}zD4N O\ `[p'6~[|S0h}HXaeUBq B{hionU9MS:vh۪'Ȓd%"u)PȊҤ堞8C`r}.OFx@cx|y9*coꯒU?[)nb DɀVsE X~̖c GW(!TAp OqmJ3eFUX2hKc6*;?*(5aupU0ё'Gɩ3ux eJxV$C4 % TG*pO4 "! %GZrpZǹ*/a&#nQmYGk z_Pl8ee/7ί߾GX鈒nW&*+b`&lx[k wm;d!oMXDùqBe(3c6SWdr&ն)X@)P*p@GRou"D7ʘе}xzW!T`%䂣hqm<5λwr[ y23D::.xNHR~1~8͉\KReڱ 4yQ|"',P~UjGCч7U/_D Or.7i\}vd3Qo}? eC{?MK+nܘ{էoU׃&iN wUK0F$@<ě s"Nˤ}oAJU2"'=e@(Okrjs,.ͣ\J(KɪiCBfv¾&aF0W` 不ːZ_- _59!vm(liN92$8r[{vyΔ}s>}Ҩ+O|y)g۞S4J^ Ͼ{/?@I[@6Xy>a[mGѩ>)qt_Dr}3Bw"Kv7rNٗĈ$όmwsph8n.m1`jIHs5bqcCqbKofx;V@AH3#k taz[l&cVU^3R23L*}fbA. IᡰoԆ2aCm"g=ްnHTmÂM(qIj(@5rb[B"ĹA{ k2L-vdP6갾2kZiĦc`0uQUSr ;[]h9і[B˞ 2ybt'-! 32/4oBŻd0v ~j|bPm5}eE:̆ouW06s.:|>{L5"GR4_dR]z^{ٛp?(76:޻ZCJ`}j@jn} o6l%Q9` PB"u<|!5P>V Bi>Q+HXQv*ȱy/p-[7{ WG;P+J̯]pa~Eϟ]dYO0GoXɦ+`s[e֞^W/6'0N،{ړrs5}*!p{/(Oa}]NJIj~ E$pOJP4Mw:G/Wx*g3F/P|5l:mS=G9.q0@OL6;AnLq[Dߘ!TEo0!0|q-FƦL?5Xq骵}\r^͓o.d` :5e_v{}jqZl.q1%**:&zVzXYa7}'_Hmq3z"H;T?pLaKAdZ̝7FNXeEFsF}= vv@N$Gf>k;$j~S?*#[(5 D=nO lC42D.v(j Iv շ&-"` [( iD ZUTpc5xĔhB픋}OTo/*2{ fXbf;z<2ZN,ZO7o-CN=Fbk(,gbtx۷zG;h?Zpd޶QMۡ9xf$Qvs:ظ.Fw [72rllY& dK;Dpؘ5/ש J[*2"En$p,tP>>/W(@at5o$Rxq#/DQ@#m1kě6ȯ:bR#|v` 4U>,6>9$vgﶟK[.7'GQI7ܥWeh'?׿^6.9t9E.xLc-/El+1C3x`FډJZjzջkE lym6~u)a`yHB U#gb{'yܒbgp&wNf#&xDPA9U7gu벋CnFa_YV InOQ^lOkf8/#>f!tSf*iOYxzR/(궥zSqC(ԠK[&?=_7]W߾;=3DTQ 0}~/#Vbe Fzl6}%AR8,YOSZ"]dn B~b<ÞB,.,T-XӴՊ3nnRޗP~Y}P5xcȀSn~MzXjo`{ܳ_G`nIƔTRB=9Ŧ:6aECΖÿI ||#WDei@^{D4lQtҹa&[)W)B*/zmn"L9]m@Rm)ZMwO .xԴ`9kI`'h!CVt5 'Vbw+\yde:HSQӈhq;ǭ-#GWSC 0b 'caB$LظT^\F#]&}@}HT2˓X~Q?ijm |n J*!OQHdRclj%vεzْ 3S1mSҊs4-z N||pp^e;nI X[¥TCzwmI\ Tq!#}09|Zg )] ~4,%xmԄXpS#ΉPm<.ftvZŴjcvn=(R'ZX1=D!\9rS(uq|آ/(`S]iAݨ6c yAPJ!M6U&W&<=uJ9=F~E^K'/F<5}Dx"5`56;uB43CG k{8#`Zpf𻬔c' 8 aAAlhbh}u͇h< oz wlG HQK.Mmʹ2j) 5,' \*3cmħQRQR۪2|Uk}*"mN3ph;˅;F1xZ !8sAR=[M9}y9 E"t2*TlHOz9GiV:#(WFEOwT yT'q(>_ўņv o\ #&dd#!1+?$ >OC;Xpu˄HYN~eoXYgdgc_}h ]v8]u]mdL-]?(>~&UFdRM̾yKzݺ|W(4R#…vl*ĘA']65zpB(~>9.6`m)&VC3zєps}9I [8gk]o?. GT4s-lr+|C}wBNاg=e:jcog>0ub008-=%5H7:]D}Uwo2t=hE\zh&c51d"x1K֪f;).vs+:)X,Nڭk{}\6/&Ԣh㑲]Alb5l"cM'ťBvSx$yF>=[2U1 wC <ʞ+R8V6Y, s1)؝G Op|&WOSW5&:U=B8h 1wv$BkufDYyKl}z)EooN'`_ >-`g#}!<\F Fa?`~S;3X2 A.aC{D;ê ܑ#y+%HP :vˊӃKEђ}8Kגshʜ6 ="N?) #@KÓ豂 (63bS2V&,M_zARQ,R)?dFbQIz4>PUw.-N(1 fϏ9 B;&CuД|wSs]?ےП++t #/9XZX@7'&%¢{8L-Vs~ ݕlۿA#.D[;w[6;%;U..TFs@m1p+sD)GuYDN+Տjh98tzB$nŜcn!`ʴ3QF` XK&KFlKn?$ u} ׌b%҅2٧=}`$y7{H>I>h e6ͫqDS&h!Pk}Vo?ҊE'- ԡ#࿸R#V3]Cwn_<[%T< ~i{[+3ּ+t֋afpmSi~_|.f A GAj=%QټՐmrC,ӓ} 4.\|T׎[#7,a½:Hj:M|w~c__>BTq3rL*@h2'65@^+L9`2̓(דa3u [X_1{c4.O\o&3ڭ溮*pi){+cX0K!NAՄi(xB Fx.tW^j7GiqD?Wuζ8ܞ^_ϼ66I}y .|U-:=)e\:}w1{NqK kXqNw=H+4zKWzNQKG#}U ,8 *g+R Fhx ˮm t3_Y2sh`8ɭ¸Y(2a6ER:3i--MLibCb6qOw! w;4Q'K\%#=iλ@孥NСw؍қXyFcg"5_5$f҃ȓi(VPR\ 3PBA&~+)e)ؚ.Ǡm-;|܇S@DžɑܙdZե8+iLjcGB91N>^: Aɜ+u+V(z:lqD; Y)*q lHG7oi!Nh{q:uFMV T*qV~m0겔V[j@$'Kl~M/rQ3ωRQ%)ˉ_q?aaNHH9G,`-AպA@nm,yvзU=3v!<+\'46«c|D `0Jcm a2-rfTAc ]rS1xEj?o 3nPV1ŝiy9ٗ)y|,WC. Q&1͜47qmmOc+c=EPk'-<_]|`E>"B+J4  %$H#!֒4yjF}?i+VtrMO}m`_XW!ty"P+$Yج l/DrQk=nAw]+ʠO[\=NhVݦu+ZL(ZR*W ¬vMcE;}E^V ּ'g) h $^o4W>&kOQEvf#guzCB:_xfzd&oAa~SB~Tr y#_Z"oMHO:qj>< 8bWDV+%&YU@R&0+? h[2@E}63 {`4K F\9hoY#xny 1s|%t>'nc W"ֻ^bWBՎlq>~M@Q3{ jѡw{.zK7hI &F8`4ۗE_y˜]- y4E:Tk4uaUQ~bI%ȫ.KKh$OOd!"jZ6bZQ,@ᾓ9(ĨsՂǬUfof Lhr˫] AjR1EXu2I"L1G¨$߾Naf2|Mi/%G`8?2|9Rc-c=BvXt\,y( K%kmPBJd=Lj[Ĺ6[DqUĝ%F|!TH{(DSne{*U>7b 3e<:Kw3eap=If+k?NN/ .B̘AKٽ`j 1FFFp h#X]mS_$'!}9E͖7DAT=*n|&x$o4 1E쁣Ց9LR kkIQk҂= cth]~ $KRB\ C"DV^P[. CqvP|c=Ҳl[=T';lSE*o.Wr.j>"y[Z=/I7tEG3Z@:ϊRQ$n}UgktܞM 8ck@Ks'U5UBgYt^U:#NxZkt}IwWy \68({9/-wyR=*nv wyu(~#7ݟw(јPNBNX+78sTw ۙ\L:eM $HzkLxgqZ?o!]SmZ Tq6io- NYD4x01;b]P_| 4͢/= ݔRL/H#Xr/8:$c1P7q/M!֠_:쾐.}4}djWMeq//NnN X}pមxL9x}j7M5#/ S@ dE쪭VsE{hM|)뛧uQuݠ}%¨/W.ģvkhMu3GG E< 0cN;gfZu>pWKAv[BL*)q$)\l#h[!L,#B%!jz0[ciG hrۇL;T;1&Ӝ%TB5A-fXaaEשz\xܬX&^O웬_wlIz|]8ҼC덠a 0QLnGH9hٷ&45-*]qO; k9 Y%B< Vyyw46s1rdE G MC-ĉA]3֏bҡL f]{rrHC(i;'S! 1@>jl`B.Be%5;jZ|BʾLP zP[!S=e,yTCeł nQF;m)v z{u@O?&眨0.o rIJ~w56~H6Z$4?\族1o,iafԂㄊXUj}qe NzЕ`e OۚF;E>&>|+M0(pt[;uC?;5Bp:%Agxsa!xGe~ Rdsovn2S>?wɨxD{3o%Y|KbNAory=:iχOױU&;$7-Asnzmy\΀ީWW*?}Z]n&sj[6Gً/1f{ ۞*h)U7cЉfǁ\Ps=~tg(҃s8Si)f6Z`~^OEC m PgSSTqaPn#B8 ح(Hhsr頁#hu 5@ Zd42 7IR7]B\pI7wTrZ[NOVJ*^Q&R~a Gx>IzΕ+Lm"p[&;:͟cמ]f%LPטb<NO D} hY&bl;dL/Pzd9EϨxfͮdwx~#O`x68ȫD4@mWBDeSc֑&L֮*yKIP_u˹]q.==?Iu_௸253^@@D@/|qDŽs]>DM΢졐=Q.x7}>ڍ&v1ZF75PX,9Vt<&zy1}"O昀~AսTGGӰudd#0@UT^dG kNR:]lCqC1œXvg|Q '"#J<$9#`?+v'򸍕>Yx%MtXmwl;B⃶\&'hs#=nq뚃&5lhog^ w'nD{Ǜ╙yDڄ݆#io5l}S:+X_1@}udI"nTn+Vg?- !#!y~[o1K --2]If׍k+۩ J0#Ը,smOI4JvrRX-`@]A :s{1E/Æ^ P$}c`*v7_(AO1R}jN'\MlXHZ3t!@V^u 0E[pkɫ/\x;hmӊN)OڷtB.%#drGL^|Aӭ%@H o OyQֻfUh)>|)K/,`C2Suߔ%Fʏh/VAĉ&U=c^Ds"&! /.+d Uf.}`k畟-[U*ve1!jL$Rt<`F} u~xҎۡ; Yncj%A [4gH.P'{s99hoU[m#ɱ );t$lccs6=C3LXH8&6nʜ=<@,i9AMY+ePm`8#~۾o"/c>bnonyE W풲BHr AXm ݠxra7@OGi^A@_v\ϵ^qqX4hl/D{rybvn=?OI45$dčwTN\b =y$>O:o~*vL 4zO!O)EhT 6Rʴqmuq=OɾR"#8>zb| 8;c. ͆,jL'i-D/SitLx_ h)3f&R-Xt6 *fŒLc3dw0Rpysڨ)^PL]jk +C?Icq{^6Im;瘝l}p|$ ,}3?*{f0Ra)Nh1NK '1kN7w;}]v95w:?T5PI KhƐj{/]L_"icMm^z 6 vYc)~!"}fi,; SS8N!zTNSI&[iJ%Q<ǺXp"r,gD7Įu[ Lѫ6 RQ[~Z pBE{79 Au(c<\pX#O3 w rVvcBh;·QCJ#"J8Y8# 5l' 1\w|K{Exz1-2ymN|(gBilKbAnJdkJ.>l9Fk:] rjrYkl?#?3ܟ<=oe+z9=3D l;._@?r pf|6-@ib] c3.jE GQ ˉ&ȫ\>w%Tc4|^May@P /)P{79hxH’h/OPPxnao?< >` _S^,<@4M/ kT34zOhb S2jY"@QYcp0RT:')0QZ 4@||~CZwV2/49f~=I$Ca2VYስ7}f% O:ݞNAUm $I5.\` 5%o㳏Rv׃Vj w1,_#_#kDVM;U͛;%7w谱U1nqGh`2qa: 2h4Ufu"jʸO5OɄ_ Ũٝx6PW\  H5,ts/屉\;ʲQIJ̑$ع/@h+DG"Hຄ..ukc埑4>*蠛?"eDx4ƦY qBk'>/w. X4WahwA%`ĩtgP(|]d-E*2wþvqѾ~~TYW@ ܒӌG7!LgK@,$Oj+SjS. Hy&zI֡:o\cXN [zkxW̙OY7Ö _!*:CjEnXGqB 7.F9|D/Ƣ Đ4MtBω(j'waЍؚ`D,@gn޹V졡EC'>~ V-ؠt&.es{a0]]w__]_ kŀO2Mܼy*?- #ip+AU62'HpjchiUdK`Nѭyt1?=Œu֏alȠݹ79}!;Āk >n/&Ycкs]=rAݥ}4LʥAG [LP7&eWDI5Q]EX ZRT"fˀҠ\)Ð`_Or TS\Ӄ0C^^1c )m棸^#L :twA.gAMf64yPVC3 l'bL?U72P]UfL)igDS/8O J3+R#(rnPY{AhK \7zԹJ*3EK˓녤ح-P@W=|xUx/>FU-l _ba緳%͡o9D*e]?K1%v\uѨiðuԓQX+"G0E&G2-nvqnpڸ IC}(` iPt)M>rw +9)ړ)MjSDbJ tMxDvP(rRpRP Ljx)E՚9fց(KemB#|bg;M(yTK s԰E_|gP4$di{ao؞2AR?Cb>*zdP2(yYAꧻ*sܹ3Gt]l 5?hL׺A$-x|l)^ړYܼ6D $_DD 6gSi>\IN)~pQ6$ PQ4g)]>E.GU!1>^j8 _DWtA0/,嚸l%lI K*ɲghPX7GeU =?)u3N L @)%_'rߟQ#dŌ}ga *o76kU=ؤir+Pk0Ntd4]&hjX9x 1/HߡzF y /`߮/ \ˉ NpMuIpd Ryq9Ҧbf ]8߇3"6z9`BЯMKD#E+P&Mfrx^[tp! l"+h]qA}3E1W6:Zh'G&V(I}&^?%yK4 Ȥ)EɾT~0-S(L;$; Dmt ]:g{ĦIBBˬ>IJ1Ah?B1p0W\SHUsBE9`w5)"pR }?)"D}ߢmY{6j6M-`URޚĖ (JG{H wD~]KP1m⡤gU=> :jFG`wJlJJ3 @JDX;!-f]$ʫqV~W!<,%~ux/[D{$ =GheyΝHo$VJt JQ7AA[o͹ƅr &Þ5OWa;Y9_HzX^Q*W#&"smf i 0븻Oѿ3Y2oQSXñ'D"3/mƠPִ lrGg ̓F> ]i ʞ8F2 v9g8qQ1t=Ô|eX{rP1"M.xL9L(񮕪SjDW5aN9QDz/8ՑX˦mD]ְUf JҕY4[ _CiuqY@ń[m04*GNܔr Ϯj*3( Τ)t#12UN9GGׇg^4{TTꘖ3Ü]~DR,tÎ$cqy onHRfG+B蝚S>=ZmT.?BAdmָY6t:E<ҜI"CdQ5P_SQ~vH*՚߿W74`x8m8 [Teð YC`\ qa#%W!1dQX2ΆOYqa"KYE=&[Sf|Btbl@Cp(68AKp&ܭϺn`n]0Ly!8 kJ%vrn}ۿ^B㿁 ߚ%{:8C2jkGGY@;+cCO!6U}r4ꁞ#ҩt3WX\2+hzu|MsQC [ow#C,؎Ͱ2JLj ~4-5QրB!\2$L $@G_$֋:,j^6PM;?T7yOzMsۧ'WzҦc.vArT?R]fT̎M}~ݘ+ڠlԪE,Ċ`Y{y="{gCO J^2s`*DQmrh "?^Q ʽ,;yվS1k-b̅U<=rwj` #vvOk-v1Z1W鰒dTX L"Hh¢'͊ 82ϜTF|hM 6;+8^l_eDy!/z ϯբ`O'~Svt.g 6@[.' vc M+iYpwVcQQyfnϲu^<(Rst4 "MGtjl-WLGSBU]~Jts9/!ΚID/8z| 'evn_LhEFCSI>Ƅɼ*\rPLڥSЮDvRUs^`˺q04w7wzS|5 $r)ͧ0^D e@pζTjtR\Tć\DSS-¬*̲m/+[ K:|+JADB¹(Klk l&d}:=yov8/ʬ1q_p(m_~RTyػ/,S+  g&啊q03Pʖ\q7''Ƃ?wl gbGČ 2 M>jIO̝Wf/ Tdq rֆ/vŇC2]xBXo?JA0=V E4Lqxy6mCj)RcjCEECVOs8o9]q=6hF)ałrH-#/.E<->1̥mmBp3bK[7Ş @_6@Le cv:Ɲ'_Zӹbq^m dEabFe;Cr:TuVlκ1b:~?Bke qmW vd l4&pΞvgLq^|&[* 0uʫsۖ|L6!*/IYX rř3D@܄Ќ;AfҕXoQg E=*pnI}o> ¬)(4S/In!8xLV3 LPWlw(aINgE^K6Hw,YߺYF_Y>+X1N B3p@BW(w0B֞e5@w,\سoB0+ޟP~]9.^גlL wآܚg5.IJTmJVuɧqvԷB[m-%h *bLfdN׿W]HkE*L]Y{R,!)8DEr YF0"3yQ v ڟ2+\V¸='"bWP ;i  TZ܏n[ OC]kƈB3 Tw,}4C ?sqr)e&2̷J).LV5c,zX@KL/ɬo/$;erd)Ho`AƄesmTאf iyS{ܡG'秉'7ijj46c覄 9pwrIRJ` &}K28sW$B4miR.Gm7#T/Mhs ؘ ^Xk? 94#gfZo_9CI)&Z$6WO,~$/U"`&pD@c)ÞY'c&SqgGf&yLFQVR0\4hsa%!32*gA~VAW "n$rcSs@-x&AH[4HH\!S.^tZryM-%9]l䵹lQZ׋m0'T\xs-%m^T75Y:؃&үY!#{1OhnAް [gpEr?ZC} €l.+i ;깭\8 +#z\N ѰϝxUdc_lϺ۫~,"-J%%Tڀ]g/S1TX^/Z2߿@#:P5M#A{Ħ}C:{pd!q9-\B>vbבjB'~&JXYoͩp xD-?z@O+Qْ<fYn?O9wYٌܗ!<NI}cS#pRW1D-3 Bp@}_UnK gڻB筝N8BlfԽdlZ1=q߷aOFQ='%im"SgnƋC*7RD\iuՅ*U%i鸮0$=go-vj9!Q?D{cS<=GąXPp&ĿZRF"fCW3݅6l]?0OܩhKg /hsnqu Βabm?7VF9f+il̓>hP9 X[ҹ!KUSIFfN@6Y{x.ޗg}+,0'L-_e6KHʳ<:,[n RAkM(.jg)A2Er _ApƊJ3;$+@8DmwR}mJ-{ W5ߵ A FᦲM1G,~ XsCX:9tW Fpy:CE%~^3O'biO8/l xA&gW[jC3 nwLm>1MɂD "gr/&Nϻ囿 ۶rб jS`Hft^ d83 dplYS:c_~#t*Fv_Dq&.MxȠkF$q!'vgy%}f(hwΉ F}b&,L,yn|OI 6}l2sSPG@YؐxJh% z|' ݁zGsm) )K'XkBi.BKnM-$f}F/Bx&IC4 MM|0ۅT1.W'%24ӬVbE GENCSCmt0# cG^# t tTJ2ZθU64p+95NjRA$&,Bf-z[Ah@o4f#ښ) HImә{URÿHJˮdpx:eui?|Wa,DU,|Ԫ)hT=R';>I/{Φ9@NzOko$+6)HvP\]AOƸ8" \Y&CdWGbE|jӪϪ^{OkmB)wYCHkLK9 m?rZ$kqQe>;thE0XTv ?c!UX3}ٞbagoA =#MQe" 9XM[4ǁJ=X.QWw[m& -!B'Kqxybetΰs"5|X&jKzϢutv(_]w95y*#t>!oVx,g}6~`a{9l;GbG#r-:L} ٪;#ϝ4 5eU5%1yk f Ray anFk:r)աZ$ !dph.^rps 5eG[RD}`<nCOCa8픯sX@DŽKkw9L G, Fv8|ێ핳 B3 ,0gIzrs_(s1_#U4g.Qm}_d\2N35ۈ˂W9BoCV1XFbkz?rx늬mow &޶I>!o> O %ր֓O9H~ޛ@tMCPpid ` oMSp0Z%k]B6EXB<żF& Y `O󢫐q0G1 X:?TWM-qFW<~=ھl`/yCR.K}v bGjB{qoɭw(/opP&J!"NAYCU{iNI5lI/ڟ#*lap麷QzLB. ehID7 -Fp8M(ZQ/ 't_)!K<&xun_!ꤚ_9|@۸;Ny6nKL+/Ox>:eEҾ ϋ^ BoKTgNmq]E[i@Ez̙^楡QW$o/ HMMe-5wA9jSBxe2qk )8`jdxq&4,! TMɮU˴$dJ7+4ۗ"87v;r [WT5ؘD~:u12#)VYr fIٱ"rmiD/gnr^ R&+j8J-f Y2lVV%^זI&KoL.z4@iD.84,U[('tBMfSx=Gp- GB@NH&B!^BiK΍aċ^ \}k]B}f5DJuRap/ P7H)Y6?\wph P> i1Q f%Pm[V0z;=ir #x_cx{ }encJLyG}tW fEu+! vѩL7)/덺.fjt65ܶizˬ*ԚvF%t7vIآ)?29%]MHP罅:_8aP <~ړWqzHX=3WTz o CbIw쁲<}։j ]S$Wm Ȥ1ŠBR?QYL{͗A]/%A⸍5䔊)[ h}_l#>kzu޻4y!abCݖ]'weU=qÍʃ ?,tk$b;d=خ0E7̳·d!Œs"Vc 8I8ɶ]]3uDhՐ΍'_?v`2y(8d?x_b]k0%Ke*m5"1P @y/Ar3Aĉ%@mV|8#ΦW^cdOQ+s(Fv<m$SMZ˒Q^NWZ jh1aiC|+=j@c-_!2Բ܂V&>ͪ saRlu#ឪ]LS);bL7-8|vH&Z^ˉf2hMk7*A!r,HBSJHYT/,AV=uxO^MKm}muc/3Oga0AlbFC>T|nGT7E!~q4釺J. 4Tq+`kE% y*`KJo1y.KbpbJ}\i<[j(5~9$iMiv5۔wMaV*I\ paiTB8 3.#X!q~O#n!{ <4Qp9bBLQ8.$7Ƙ8@^˹<8O/%^x2>YEhGEv˭`E'p޵W4ې Nf ?فA02PL`!.H) yɍ?-)\ H}!" `W;8?E`lC}Z!RT(#T%9h>< CxpU ⬯jhy6a }E5yJ 7JC6ƾM3~Gh680B+ V1e:H؉cI}LL"fHfy#ü;z0oR;j3Np٪HL$ږ5BGFd'B%#ɾdވ}AJA/?—lf-3 $Fdj8&d~"Qz3]"Nyl>D=dٸw1a4A=B u~5w-(24p,֬1@ j,ry%wIeNA4/&4]GH1A<,DZ_A'G~N\M쮶7w"(B/[g^M=09UqPBѶ˗x'aӯ( VĜPkf ,Hd_vL/':2ȎgJIVU;@AdrP`o re´I"CUHRC:DpP'^dzs>֔|0Iݠ[.,  i`w΢#_ڬ᧽@Y+H0jMF.Ƞ -$&d=ǺF[ܭ@HurbmBc<fwfxWm<2[gYФ]n~q!Muh[g+Gᷖ7 nh tx}KxA %ìGZC@ 8XB[7o"=S`-3\1Z,W`^i+wiG3~\D_䭏/GCNTU^OBH$LcXo|_0t-?fPFI*0QT3vq ^nxb q/;t2,:'WhT%nW}a2p|RD_Eˣ\T!0 T~Ill'\_#(6ܙp̍~5ڡ}%clnu^7!(I{fTUW Qs454_;^.vגɇ29# s|_2 ϤrOybwSp5@SQ>+Gr^?bGM;p|H%)8IqEb$0˲NS`&BR)Vhn.UЮ55FjBzo"(~=c]l)):!^8 ,|e^=jDFqi@>'7&>\e&|9awHV][3'OMF=dژKF~:'DuiyV*2@<[ވSrC%*kQ&20kŖ:7,-p3^rew^ {1J^Lؔ-w5@eWVծw4̒D|ۇ3ge@2X2xG dQV0 t4p?@.І&XWEw~">mh\JNEmx@em5%gjņ%Gk' Ii~<:.1yO7õPY>Q;CkZ\L!ao'޿pW6aT^)~ٖeocB .kfO/M'Ig~,QX[S P{ ]t&&@-C:M?qam2_ 8"oX&sAT2F ΍#D Ƈs@":cFH|hM IzExFEH޼o /PQ~>jm z#63#1tLĚ+K;n @:u X5$u\~)3z7&6B VPVcp/[6>ҍōϻ\;DJF8qӞ(2_^3x-a P:X %^@l*ki.=:xØ VW<~Zww0.Mrb߬X.L׎U%V[*⃠nrSdv{OVav `]! zAunF+|^MqdL4 @P2%p,pX}̧m`#W!Q}U$gCYF1ڑZ`mZ12hɚvoCר3_(*-Zy6W$Ȏ^ffG_[`%hkԗ끔S~a..Y_<'r?CTP9dL֞Eʉ<ӎ_>qVA9)Ykv 'mTC}:Xl7JkDr͋w3ND!2`-Vli V#WI]!D`&6OfZ,zɄ+: B X!k ۪2Øk~#IZ69IG/ql 2m[x@QEߛlˉRh|c搽DϛM*^r|ԕ#1׽٩ǺB3ׂ!ޓ ,S:ht/e}-aJy廆!ӍA9@1͌~}# 0*cOn K/[ c1ӭ :oK:\@I\ґ<Ō?}^h#vS=ݼXzKN<%n+ZO_W-J@%L87s~%+=#F|TT 1: J [Am81$H8fc2p87[cQ]%=qv,ʯ[@<|^I_ԣ-Rxn x/c 1hq%DD.׷zb":߀qcBO:[?3[$^kHTmWȀHT$,; ؄ @K[%y>;\ +i-N37h!ڕD2va|-𾴲-=;4myŌgd@y;DN8}>a [U` 1N&{NpK9b9/;WbRX(h /i*e-~/Y'>%=~"Jڽť',W(X%olhdn65 3Cl$;hz>TLN FnL7wt۴? 8"=Þ<,cGJhN1ra?thVGdypWo !/N}po\;ry b __"Q@ܾBQ}vr>{][w\MKQnq Hٲ|RrsE~v{&/4Ӛy켦NkLE9# DN?v} ȑ=^6( %il5{̎+mmw jva( \@29^BL;n٭WឡOݠ`(ÏOdu;[G)[ɳ7z!F:) I[bӼbJSViLv\ h艠 '(yrr*nlUiY5-jRg{7~RAz8NTM+V~ /iϔSjj1+v!2Ӽ*ŴlMGdȋY0~4\ $*ܛC]R|hub#nj2Ew/+CAcP}c^v4>@)u֖>hncO:_h餿 E[dWUTRG281]IքOq) s:km-ګTٓE][5ejB%ѯ "Ȃ̸ ~f 8N$ь82d|ʪ҈)sJ_}njnWȮ9%lh=²I~&s+aG?RvXXZe\_@G3MA-cŭGdmfۘFcnEBwC71ZE;Z=F[\Ԧ$:ZS h# W%T'ͨ0›5*ʈ7+ qǛ geвlu*rl(`ŦQA -<lɟOJu(tj"J.^)q~ ^O8'h/baEA7gAi 2G4w0cdXs{9Z>jΛG@=V/&O1Kwmg8e)=.*a=/wFzG9'!# rkxъP{-V6diP24"yY EMq˴[V.JGPm-o~Wn;R erقBi.4Q+fw-Fa5/+y+E/.^~%5LFN9sbGARכXGr!z lMLg% 4p.6ƴ+nvb >FT #jtFyanJ/NД̌x !3?Qey%1J#zq;LA+hQiAsRxΏ\ `m_<ӗƲD>":-H]{RB´S\Ms#'U='fl&%x݅E;ݚcg]^}svURUl$eYHD@`е\9h]ĉfz^3]T_}W F*ж-z Sʟذh!bmt .T^m7ss'Zg%-da.Š4d sv&O!g?PFJ '$Brk/D ?&#R*/[2=_ja tv{nmU8E[ l^*  3pryؗ$D7{)c\r04R?CbX(m!|^\3ЖCMuH^Ȃs!|$y$ IWsbX-랟RBU~ڕ%Iw H&z"^&trum 7"'4p G/ yq ccHjH־=T4tpS#ֺL#VLݒ7f /|5X:e e_lh/ K78JyN%u/6Xg77 Lm\IwN4MM#l/9)pNCU6Q=wN2[,@慮oe){' A茍q*֔4]n9aT߷), vP ?N [s;ƒ,f {k"a񞃺t9N|,\W:#@?(F6Ы/d}h@%m+5`>%`rv˶-G,.x.1R4gLb=4%8;sP5WB\*Z6-߆{y0:$Cu-B}EBLh.%K&*/@qP6 "qI (oא63ruX`* 9D& ΍ o( q}$ ,@z"1bLxzu ~hnB%(do1ƌC.޶ W@]b'E$:>'j9 cWX@۷ճ og<(-ѫpH=@rumYs-WMp(h<25b*o81/kR0ͣ"A PQ5%/f̩R6~ғg.o Y\? :(U ;&%aGo͋(̭R?dT['֍ːkծ*V]_y-q!wvO<`;PVY%ajG]aA/uVP4ѪG)i[^']k`̡~yq*ԉCBB1SDW[>>,[<[Hd"Oɬ|l`7h$]aD,4}D =0I9;Z֠Psӊj^ :j ^\J>G%xDOL>:(a'j_RLzS 0hWJByۋ* u2"7b_d+Ѻ fAe۴aK 2cZ*Ag@csi6p_%]{47/jځ¡N }yE@""/'Ow xawG#`C aC#S5 DID S plK@ DgKNKf6,!c,w/v}JPY-.8,h Ss>04ç*8Eizk ,s`xEzEXo,u\`!-o.6L aKvsX$U_(m lEEz,cuFJ[yÙJ0.~\ _=&</6|fYA]b+x- 61`.R#xihr-M 3;!MHFE y%u`H^@[/O2ݾƣH2n4]W*߻;/ⰒA*}e+"L5w;\/ &tqi-òV0W9fgc#~/*git,2(m|adО(!8UScɏI7uMrP܆g<2G~tm,~a zF)z3yh̄^wUɆ^C늭U^w {&TV4 8kOiu:A?ve.#Oc[|)YH.hyaa" ,4׈'K{umJ_#z ~rX^ftY7/5vȰy?h}'9^mS7vsf0"R$7᧲ !Tģd~W~B/=*x&y.- & 5vc;ڣW3 @,}^҅@u&/VPFŏ*ְZ6 Kԋ$pPqB X/IC,¾䟥hX^ *7;VnAwP_>M 漌!рٮ|A`BAc|1ӌzKaEM4{x0)D*uz2}8\-$[`Bw8#IL2Z$yR?iN}=&v)~^$'=V^.E4hԀXrSJѸ i`RCU糼JLϑ]>o %fS%1yl!%*[ɚ@\lkb:R庘8JŖ®7iS dn@8\40)N5_fw( <%M -H;z' F-ƹ}A[Z;_!9ZqoIX}*ΛC yojDj9 6(e8)G`D_su #̷2hdKijhG_']8Hk? FFv/)a4u(^k9.},]Y;@ pr8% Ms(9DY~r#U]GLfFT=I~@nh Gp3uda9{M㥫&, `+ց9/up[3ӡ 1i*C y'2'4L.{)H› g6Щ9y?`l " Vhh"-a$c4lPMKm!88$, {]踯lE : sk-DmV^]^ANruA鏡̌5[Jܡ'UU)mI>j$2t% +,Xq2 84t$nQhBi9"vg6"fLd</l6֍RΡ GѷzoK r\.qJP#RIN|DT^4hc壉*J˘0*ięҞcUE=V@G@_:ƈ_T [j9SG D&r(/r8X'6!5:'u96+/trӂZ= pFgn ۞*?DX@ul~G.&m׶V1GV=8RLL|xMy ,_#p6!k(V0;5j1U$%ӚVRCUɝ:ZdYz_}\@6/<"xxBppr Y$K!fH)4n2Y,{|13j$8&Kgvܶ+Ҝ3՗ Mr<4"Zјm*\8 ( -ĚIT'1&F>K2>U~X <[׋ςliI{W!(:SԐh#O6m-׿0b* ߀A5hrUfu%}@vѶgDztMtWKB[\n.ײ}J˶J֔. 5r9[*lScHp i%*XJb| UZ{ |Ēt'p!l q$`CjzŀvSW8l%]'6\3ǣ=zsC9c9 Q[mÿ*&^w&Z__pUб'bEt$v i@ظtL1L.T_@h嬜xQ_:MeCu5X5is1?.ȗ R81ľroGz0JV.מ\&?M9 gx[T-te#uۊZ1"=h\yKtJ%QhBw~mԹI ]Kثg?Iq! z}/}b@$Sz럲?>Sn|IK:U&):+ &g@ yL*86M99;n7Cm6"]% Z&W2ϐ.&&ZdwRO\z U"a+H&DE%`^p]H|h5 LyQgy hIm$sPDSTRaVQk:1tu@],MQY6N6 HS5U[\4=S%נO\6Z0S6lƞiAɤ~jw7u)DmA2mPWN,fnѡטٱSE†YD^=f{gJ _ r,Lloô˴ƛr˯+L}$*IW~?rEQ5V>Ve,Uf@$971f{U cGlJ)5#ZM8,ͭ+\{ ]:,֫вN䟇*{fB{c/ђ3t׺R{Ըuv$|nNV{ܨwYd"1jlrIdE#%|jqzFB9k+zQ XژB[F olb&:_w%q_4DFc'Mo `Duba$q٥W5#mg Vv ¸A9I8ˋX"0u@s~Pn^VkJTfpLWt܁1!zF W0!N"(T$3mjG7fjVpb+[oIHPu>=_dj4Tg~x#*&R|qDn݃{0M-F/Η! 9nVHXƶfAlGzғ*sR4, f)5#u e@W:L\kxc3~檇)yI .HmWi.5#S ֤/жXrkH"T wHݕEUanG(D!zeOVRGbʧv$g\{xFpo+ fj-ӥ)-{XșGf*PH|~ܙWPOkO8R}Y;C:{ 9;̐ݏFY1a8F/q5er1g*_n}SSxaLVS7•h5u۷7:Zq6 Yܨ2$i)le9h6_T sȱ[z~-ygJPyڔ=DĖ:~CF /)/&ۋ}$*QZ ၵכU")]]E(36wGRCQ\ѩhm}PBGF`8MeCJ:C {Z'wWX@<\|bxzTc6G&!5jqԣʍ2[GC0 x@Ik*flmp4>6wWR6 HBp=OZT.ܭG'p0'=È3te (;/wk>ؔUqjŸGhcա"nH2B.E@:ٹ NPdL/c}?`-RIr𦕔5Qn>a*RU3d-R1}p8jG"m/bUu,"ǡx0&Y"ǯ :msoNQ F\)jV 'M;|-fBff_׉NJ ro7fn?FV,c3X;*=~ lZ]V b˙)Q^!`dp%yZ$=~XR9_b! <+C+|2WH,A&m T&r>+f Mt[>҇oYNgZTZmQ=^`Qğ>o2$ -sQ N]FwddO1Kr$c,$g >bO&Zg^7GRT [$&0Tm2-){8N|'ouJ6~TS&IOꝸ#96B"9o4 G[e ͍yby.e{.v{|EXB5%;+hHbR=Ċ_08ǷP '!\;7b^ ''@1cV[@^FrcTk:&]Zɰñ w֯m H$_?]\'%]NٞGOj83\3$UBٚq|ɺiI'!'HȪt^ mbrHiga^=p>B|E E:Dfjҷf_]_q[:Rw\w pvjq8ft#\N`0-׭rxO3 CO2T ÿ%^|;P9 qK5h~ o~ob'Jc9$`xAppd heVpݦdWF^%A(7/MC*4(11l쒓"#xv Z.lq, Yw%2WqfÝOS)Eebjd~h ~UV[.8n"vm&Njc0ӈ i}6ʞ%=FK {uKԊ{ MDٓ>\{ AVDH`" W06sSԷ_5Ɩ[b ?6ez n\_ʨN|Hc3evgn-mk=lw+h>- l 0(j%z~&8+Mǒ-|7C/d?>:J!? D͢xJv \קˡ4pt&۲PVEoKOSkgm:2$Sxt(/@bJ\u $òLtE{~f|?u$ˀRv mo!U@y6bbNGT89ϳַVv|sY886yfgJ`<])tz|Qa3-kf+[F_ZV&G]ipErgPJoN 3'.*3PCY:`U8E9yl3j/s)+AJf#Q&^XPssw&;5>g&Mz.1G4yX2[DŽ܏-;X#AAyf*/fIoEK x4U68%,~DB>vRyQgŰ`Cz:FSe%瀅r{bm,*џ{"cdsrPp nD hQ7$YNSS%鯴4S_?߭cӣl[OOtH۩./?g;֬LEbik)pO|( P <- `JJnKžSqjyeaq )5#N8ѷij!cpDg<,țfDm+x_9G򩔘NW'}u걦jsI4ɝCQ9.xKIZLڣr^O 9yMsL)>AПZGrvFrety̱*9Qw9TKv!eU,@%bƺϭ)S>%S#WshX4ko",*a7af =t~a9w-9;r \4K_3y+롞ԫvSS#`^nB!yX➸',,n5g_s",)ۛg$dv -3%he8xVR!RHwz˵ #4gƯnxK=vT!|c?%weG!U?r{Ts qͬAN`Ap x21Dncm?x' hiܣ&Yyf'fWZ]-~cQD^cWc&?]2ͶsIAe yߜ7,"J3%" r.v뺷.(XC7ڰ JV,WEZ9)ᬩ@.)/ehKBj,TgLA!X:$MU`msú$A]i1*;ឩ0o3iw&h= T>v!ܖ3*L}j90[CzK\}7Eg@=HJ|(bD" ZTjP:bJڠ;0y&̳9 xFa&&LA6T6':sv04o<`-*y>Z3'SdpH\hHobR/֔yKE.UkDR4B-'Z?Xqݓ}kûGiT\!uA5$01\(^4\f$J~u}i6*24mZ y$ #Ad؃KbH+X^#[:mjxQjvǗ|S՗FL \@We>?L+$C mxJ]em|p59W݊#nq2N&q$v2[yPc蠘V }d2PM8ya]V3S(k1aPqs3 :dC626> ezJ޶ϙk0TWoq8l&dF4&YLj+&1nYYXm,v%}a%EQMmVwPtlPr&|ZZ4uzy3zY⃷W6D-cvl}x)#vk6ؗ@ 9x.1 ?5)93)/!֑'4^Yٶu2vv#kSQJp< I VpݑV,Z f@ jqf.fcL;`r,Ciruzd5 k Em%E_w3HFhcg*a\~dGs.;_A 2=8mZ`vzO5: .Kx^lŹ[d߅ӴqT!%3&wFĪS"T~kجGrGni%;Vi 'ϧOG4i]4x JǁB5oa E{}MPV? [ *\…%Oj*XĠ8"upoLSFM>5 n͝jns B~g(ؿ74Xo],hШ2riEuɜI)b۲]3'[eROs4'X!& :+Dbfj=ܼ.VuPGP  ]ȫDx;׼Lr+2b;Y-,e&#H7𽊼uH+!܉]O}D S<P{&XN'} #teoLzs-Өm$QV4jD\f6=gV>s߂,"T }CҔ_%Ҵ B*A; LXpO}XP(La/WuxiSn׷&p-EqRҚV3B.fr=GrVH$Q4ƴS{^UdqU/&1=])/fei<^1d $8#nЫΣ"V;aPq8`~=V@$mJV"cgSVQ61f--CHC:+ NIܔNʗ}ǖ^cY[Hm15M91S} OIKil;- cOw/N <77tLGkоfU2T]R *j);n!V%WG ;zp#27ج2(= A:Q$2w* JTF: f6L**IWc ZgH`"RdV##@x> uuԺP9xqsκ &v=q!~lG$xōv[x/ȗmv#Z[.پ'K+ #$ j&brI L؁g@+Ar|l1C*okrZl{<*&3vO7{_cw $~rT( hTW|~Eֳ0zm׋'ƪ"Fɔ}>ShVLW/#;\ۮyG s{'ط;N0~zN7Ϥ"iq`p-]oisdZ >}FP?Շ{TR~G#A v_m|E)yFԅ6'q:ETDW?U/T}Q-s\R n~f[eMRVڭ-T?.%.ǮAj2R!|/zƙ W?sN r&;X5`0-qO"$κ~T#W{D)](.3 ]j~EKYG¢J xvA04Njˎ<% ZحM 4#RjWk3) Rvg[V8+~5J́6lJkK{"=ǖ(=Ȼ#i̚^bCuZQ'p<_$6a#ok}8[9i08i@: -F^}T6>>[toA.ײTޫ1@*sc++ǹފH79nj&sdD6yN6x,S[ tXF2|Dxǐ#fړ&%WI[F4H)f0r&܏q`nT/pibid/jA~IdZhڌj6< Y zkf!Z$hx0q2ycQ@x>W$$)ᑷTI q4I]$LSš )br6E̊-Czxh u_¤zKil};IPZ'falb@#XcŤ኶-5rXI,>=@$k/ۅƨv@BEPm@~_Iў)epPO"8FC -KPvNĕvPg \XI/Vd:liTZVz%4._OcXH=>3(` [NnDt"lT>8 +J_XΔVY iwNEwDhF5  bTߛY*#i "2JɎvGKEN)N].DYqL6偣4Fn?GEx\6UU3PByyY˺HD߲C^Y,$ވG\0) L=M9҇|lڒ$b^b%8t/~ބ4Sjhy B/ݩAnШ6&;`"dHˇ\55!N.7 "G_#߹_!t8' YChxe˺N[ͫ b}2sA-yDnw^(փ{,Rͺ;tydɻcbyRO 0AFdʏ:mI'4A&e{db f'fkc:iL!Ɗ +N/Q2g߈p 75ZGd֕>aSTCnNo#9*@+sS C;R2^E^Z,bJ[CZ&XczԮ{ 52C7\zicfx;Ȟ7dz~Qn$b4c}3Q>.WD:/_Q IE)ueV~ڐ6fR hg?n@={WOx- ɶΫIDEa{T39%> )t\kqϐ0N$&x"Wm}L0Z:8׵~0hQeǦg$$ZfQK[>T=PZitrHD!W\sč,` u'vW{۶6(~vz3?zv#e&gR77/ c?"_2eqq 'z*lW{j4/6K`]kV^D3R`[9gQEe{.sk^JVTcсj |no":ͭ-`$E'7\QUUmGޚskrA/%9r9ilEVo|ּ׊bw܂:\8՚Q#N+W֒a7/U0ޠ\`!oHy 5Ψ6Nka⚭GO3=CK_b"J@ԀbEǥ-+nsv.mEW'|IM b|ڬ؄eԢ?ʞL^;$Kh:Yٿ.qϐN4EŒQd5iRx3*?hmS(fX,ҧ鴳(XBL9  @2O%->"ۜqN't­ 8}|'σR붏xšc~#"a~C,[++Gh82.g/1zsچc~@X0̙* -LUTbpdj/ bawm||]yٌ~ esSG*gV|MuZ)GSF|-ީ9HA'2dg}Zmk|lHjw~/Hs륄v_@țDûiv. 20vlCh  6J?^~]4ls~-9=čvr (^vuA6{.8BA{JtG%5rOjc&/F;޺s3B}r6  jO :Vqc7\A-uVT~f b½=C&(ۓQYKi>PdTec-( 5b9z(!q,*BgRz6tx͚,gc&D(@}ЇGHnd@_] MV>Ҹ aa u["|nR~3\+~(Z(QMT&5X̠q-&!֨7asYn'D75F9lFSP ;KEtArvѤDoc Ǭ6Se5=鋬DG> 挐҃(ض/GHx,;NxoigkށAvmQ 9([46B j//jo%E,RG2CU컽}l,>,$ RۢîR=؁MORJ8uR-vw-]ㅁ!LwܚUBZ Bӄ4땒|pbcg 卮 qxZrcP;gǶzr" : Gd2Q;)ͥV+oE ё;{P/џC颏 pT{]i]->IY|^K|@fE Q/6:+FTLWFL ҘGTVr#mqOScۆ ^O. Qril_ э]CU^=WtHaP=?=G^aN,RD6#qš^T\#WjMp'zB;[6a ]%pQtri)MSG,[J,nbu`pm\~PbnxT31 U;3 w^"nb 9dKxN,:? 7,u-벹hX M:*Ӕu4Z |18I5 H_eo6eHD-o|]'c!zgۆ+`)%8i]2Xo ,bNw*^TaρGV˽w0PuKxa+M'3ZHv{ҧiS(pXUq+q^ȇ4iTPvjbT(i^‹ID*Sh hy" /kYEb.aV Gةl- Åf@W)\E=mhCig|#ƵO]LMm+:y+Sf H$,h+i7+!T6oE [xؿ8F":iL™"uA[#:^)B9l;4; QUkPq@ aN׭]lUGYBQziiG / ;ݕRe? Mq_W,0!t-Bz3w~ ,jvك.#gA8F=Zlg/K@폣9O_)D3Jҭ :ċ0߀"䞉n~2xHycv)+ 1GM Py}v[9GFaohǨZVDn _He[2:^ "CVeL? Զi $ 4:RceiBC[$0L_d#/EQi'b?w(GeR ʖ{VKR惿df8ې5 `mw6 Jwj>E }f,-b< PP# ;\$`@Lf6A}3s J]3 zǬwb}l"33f :b$%+p dWg;uXbDK5BRUtKg]WC;̢T"k@+O":x% #5JT {&u-Dg7#A_2" 4MSTm0gNQ!j8E /Jg,M!t{B<L>.Þ$-8D$|tsWF^eX%;C]t+$W2@(i/J鄱7\t UuU󉺓O|o2f9`Dý 9s7BEu56m#\vx(qϺ"s3@g;,XeW6߹;;U{-v3egm6՚n.0S.SPN\-ѫXpO!%tB'̙vwp-#G-X](JpkG-HUo.gw%o& ՠu0 Emʺ Up1LŋwJ ,2{˔#;^SOz ,% /4b"?Y# }e4 h2T4yI&-k7n6zwIPpf[a%f}W_vgh7ic=VuEF<}"GQL:Fn}%SQD S,J Q-ұyT4ˬ膅SgMvt+ͷÀGR]bPç!ӑ2bը2pH_GXTb+L=tYUa~~<8; TW2TZoIڿv{rkg2V\=馇tҽDޮ_6"g J>^Ȥ+ 0UYt(/m]#K emlCOڹ9  '6gfcd2TEV&r |9i˜Z̜nL} @<ࢃnx6k-xD^y 㟙+iY蹰vT^$ k&h֩ O8@V^~mG@©y̮=WWgW~ GT@/GMjdMF[RY:ݢ}(N,Z7%&6q0釸v׭qNLKO$vD7/KɗZ-ΔaFmL.3X?$@/DQ]ˢ5E>\M܌B;?Qpzɺܵt"׉s-8Cv׃0j8v*hRugȊ?.ϋ<Hx1qk6OQp)5St:/rRɏh5N Lq>85\ެA9Nda1 ^u1=r0 3rr#b^Ұ(䬆՗i%+| !H;c vIbZV۽*sсSYjgi!1ҍ#.eay)S>bUg83fs۾(SCxۼrIRhSlÊmNAR4 fpKlgTOk̿S XY>䰙x-3,QEB: p_SxtA.] m[_o\\;|GBPSS^eR|xh4N MMZǝ2糝.,XEx†{ջ`IF| \d2XsM}Gfa&%nH.e0ku(H\aόQpԐ5>I(Ӝ(&{@$*)وve~7C9ſۦU2[+R_x%.l'لP%Xb$@UQl%3v,=ưN_Ǻ5+rJ4ur DocbZ2 x=hadn;eBy#[Zj U>n9}ŰU_'lbQJ|D +*V (tDdps!‹rZ!]K _gN u*H1GdBk{A<}M;9EHTr~9J.l2UF \]wnQ4erL[?N!>o$} a?]nU\IQ:CuMs M KAMuKK?@[:2hE쐵O ʴ@K+_e~rz_}bV+#5@5ё\g=@C)@Z_h$Gn2ƹ6?M&XS(iskH."Z드 {ߟ05مTR)϶ @9>0,{- t%ԓgIZvtZY6c4xR:k{u*4f,u˝2'\%4=a#Mȟ>VLK@p/Wˉd8٬V!ɳT&GUN_ SM4uN;'OI>$ATQ$\ jjЄ0K!.@}9eͩ^4CD+Vazݕ\[%*>'3s{M-cjj 6/B!7b@oupL_T\Cϗf,KN&ar˯[#yb#ǖ< Z z9I> _$tCgY1x6=TaaoD6H&%urǹLCIӨv2(ԱsSGTZkK4=bŤO(NTWgR:?@[c$.6I7PU3Xȡ JaDQ|#K[ I@zX ( az+~*tFP5>5uB {l,e?*}AVߊ-K祉 4GXΕTJdT6וRYp>vU ڽs1O=_v7tInm[Ҫ|>ήKI l`zء3k(qأm?u=y8^,!QS)q?fRMoF; <|AiHr%`GW y j6gA^YX#VVOUe`x{}Zo ӿKTͭ3T@j\Vyl7@k"8mZ!-.foB9q6b]Eo>W_kJEJ|=嗩(RJZ'iP @ W%]Ǣzaޯ+DqH( ?γ?W0pT= $/w>S7h+6O\^ ecJ_4wo?JvWȠ6/k79sii n8)R& ^z|/8,RT]~xwY;`6im`w ( ˊb o/jQѭU35 @~D"K8ZPF )P2K֜@G/rToZx;">҈Gn%@V1`# t.5N.T#vJ{Κ(dAHu-Ga:tnJP%ʦ{)T;S"#-hl)ߓg߾H 7E*^|baRt,}}#d4vָҔVm<2g.aXP\