systemd-mini-234-lp150.20.15.1<>, D<\jD/=„c[DL?uV}G }LQI=pOф%,Qrݽ!Ǡ`ـ`5p^{GoKµ[=#a 4c]yu.B0s䯲P~l~?Ƣ/xGpNFގhհ.4}jlfU/?i 9Al475!QmNqja7x}g/UNSwLm @chص>JF?Fd ! >HLX\ox u<H   T '` zc 0< -L--8Lv(8`9 `:`=[>c@kBsFGHIXYZ4[@\P]\^XbLcdefluvVw0<x7Hy>TzF@FPFTFZFCsystemd-mini234lp150.20.15.1A System and Session ManagerSystemd is a system and service manager, compatible with SysV and LSB init scripts for Linux. systemd provides aggressive parallelization capabilities, uses socket and D-Bus activation for starting services, offers on-demand starting of daemons, keeps track of processes using Linux cgroups, supports snapshotting and restoring of the system state, maintains mount and automount points and implements an elaborate transactional dependency-based service control logic. It can work as a drop-in replacement for sysvinit.\jDobs-arm-8openSUSE Leap 15.0openSUSELGPL-2.1-or-laterhttp://bugs.opensuse.orgSystem/Basehttp://www.freedesktop.org/wiki/Software/systemdlinuxaarch64# Build of installation images uses an hard coded list of some # packages with a %pre that needs to be run during the # build. Unfortunately, systemd in one of them so we need to keep this # section even if it's empty. if [ $1 -gt 1 ] ; then case "$(systemctl show -pFragmentPath tmp.mount)" in FragmentPath=/usr/lib/systemd/system/tmp.mount) ln -sf /usr/share/systemd/tmp.mount /etc/systemd/system/ || : esac fi# Make /etc/machine-id an empty file during package installation. On # the first boot, machine-id is initialized and either committed (if # /etc/ is writable) or the system/image runs with a transient machine # ID, that changes on each boot (if the image is read-only). This is # especially important for appliance builds to avoid an identical # machine ID in all images. if [ $1 -eq 1 ]; then touch /etc/machine-id chmod 444 /etc/machine-id fi # /etc/machine-id might have been created writeable incorrectly # (boo#1092269). if [ "$(stat -c%a /etc/machine-id)" != 444 ]; then echo "Incorrect file mode bits for /etc/machine-id which should be 0444, fixing..." chmod 444 /etc/machine-id fi [ -x /usr/bin/systemd-sysusers ] && /usr/bin/systemd-sysusers /usr/lib/sysusers.d/systemd.conf || : [ -e /var/lib/random-seed ] && mv /var/lib/random-seed /var/lib/systemd/ || : /usr/lib/systemd/systemd-random-seed save || : systemctl daemon-reexec || : [ -x /usr/bin/journalctl ] && /usr/bin/journalctl --update-catalog || : [ -z "${TRANSACTIONAL_UPDATE}" -a -x /usr/bin/systemd-tmpfiles ] && /usr/bin/systemd-tmpfiles --create || : # Create default config in /etc at first install. # Later package updates should not overwrite these settings. if [ $1 -eq 1 ]; then # Enable systemd services according to the distro defaults. # Note: systemctl might abort prematurely if it fails on one # unit. systemctl preset machines.target || : systemctl preset remote-fs.target || : systemctl preset getty@.service || : systemctl preset systemd-timesyncd.service || : fi >/dev/null # v228 wrongly set world writable suid root permissions on timestamp # files used by permanent timers. Fix the timestamps that might have # been created by the affected versions of systemd (bsc#1020601). for stamp in $(ls /var/lib/systemd/timers/stamp-*.timer 2>/dev/null); do chmod 0644 $stamp done # Same for user lingering created by logind. for username in $(ls /var/lib/systemd/linger/* 2>/dev/null); do chmod 0644 $username done # This includes all hacks needed when upgrading from SysV. /usr/lib/systemd/scripts/upgrade-from-pre-210.sh || : # Migrate the i18n settings that could be previously configured in # /etc/sysconfig but now defined in the systemd official places # (/etc/locale.conf, /etc/vconsole.conf, etc...). This is done only # once during either installation or update. It's done during package # installation because of migration from SLE11. test -e /usr/lib/systemd/scripts/.migrate-sysconfig-i18n.sh~done || { /usr/lib/systemd/scripts/migrate-sysconfig-i18n.sh && touch /usr/lib/systemd/scripts/.migrate-sysconfig-i18n.sh~done || : } if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi # Avoid restarting logind until fixed upstream (issue #1163) if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$1" -ge 1 -a -x /usr/bin/systemctl ]; then # Package upgrade, not uninstall /usr/bin/systemctl try-restart systemd-journald.service || : fi if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$1" -ge 1 -a -x /usr/bin/systemctl ]; then # Package upgrade, not uninstall /usr/bin/systemctl try-restart systemd-timesyncd.service || : fi01nDgj`@Hw@h x X@@X@@@@PHX@@ppPHhP @p!9$-u=34|2W3Q&;M"C"$]y  o{ qpG.z)" ) b(ygA~j|d"|a'$ $) $%!WYbBw${  BJ1-o(iqZzTFI @@@@H@H@@@X@Hz@X@X {by|d|jJ!8 T>3lL FCg0mwTWCX`6@Bd@C;%BEcA>E ?ACCCbS\"AaCUH56 P4Wsmg( 2f O;4  HAAAAAA큤A큤AA큤AA큤A큤AAAAAAA큤AAA큤큤AAAAA큤AA큤A큤A큤A큤A큤A큤A큤AAA큤A큤A큤AAAA큤AAAA큤A큤A큤AAA큤A큤AA큤A큤AA큤A큤AA큤AAA큤AAA\j.\j1\j.\j,\j,\j,\j.\j3\j,\j,\j,\j,\j,\j,\j,\j,\j3\j3\j3\j,\j.\j,\j,\j,\j,\j,\j.\j,\j3\j3\j3\j3\j,\j,\j,\j,\j3\j,\j,\j0\j0\j0\j0\j0\j+\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j,\j0\j,\j1\j1\j,\j,\j,\j,\j.\j.\j1\j1\j0\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j0\j,\j.\j.\j.\j.\j.\j0\j0\j0\j0\j0\j0\j0\j.\j.\j,\j,\j.\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j,\j.\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j.\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j,\j,\j,\j.\j,\j,\j,\j.\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j,\j,\j,\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j.\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j0\j,\j0\j.\j0\j0\j0\j0\j0\j0\j0\j,\j0\j0\j,\j.\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j-\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j.\j-\j,\j,\j,\j,\j,\j,\j,\j.\j.\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j,\j.\j.\j.\j.\j.\j.\j.e7d0059a7201089d81e10bd06c9fd6c1cd7989eea965b67fa5732d413a10a801ad7536541463e426388c7562b0e7a693c3b646539b3ae163a7caf6ad95f10e08fd3a5e13f660ca393d66e518eb5ba1b94e26ad055f7485955ba0070eec4e217ca9b6ae4819a70c5562d5dd7d33ac4e476038cbbaece45c112c972a2fbd9eddc1f10fada823afe26846b0e7a9b2c16061b28d0c0d19a03dfc45654d7b664c0513d7d67482a821cbc7a6ab3a68f1c00e0dc61a98c3c317461abe8b7aba7ac7b864c5c8396cca2d5f090db5e62cf735d06f60e0d6356585d43d7e24e471023635fd40941a16ccf604f4783c28c8627b241975c7c380579ae9b8e9ad3b40655d1228ad04a4989bf1932bf2bb1292b3bf58609d79b4290f38f6074fef325c305eb4d064befa6bf2d52a3612da29703d1304b08c0569e5ff732dfff25dd65d5df6f483a1c04d1279675a3f5470c03920dcb0e85763bb035a90e30dbd11f92dfde28824a698d971bc314dff4fae66325e81e1723deb45cf3cd31a4402f1729e69c4a73e845ad601f6fdf3b87c0af26cd94d9d569f0a17d6d8a6d8a7af24ae5f326230e36ce93e43dabdb7b1420171b8df78745269f90ce8b9ea63b4458dda192ec10d59f8395880af8904256746adbfd6cd2167bb0ed11d32fc447931ae648eeab4b784374f0e68a6c1ef4d51a706ad86abd7dae01c4000029cf975f4adc89b02b987587ea2048b626297f2a6dadc9ef302ee4a718b4878006150a7f9d99962054be84707f2d9c2b694c4f3795fc3faab8b7a74531682dbe26a9b0e44fb684f87f67830189b7a08340801c8c35d20d297207d4e59122cf763f1521a7aa53567176f70523d8831f653c5795c949590484ce801e3662d18904a4fae63ff9990ece095a582cba5943e030b3abb54df1992cdf6641143182da92113808db4925fae5c8678347e8fb0c680bff4ce19ffcf07d3a64ae68750721edb10d4a4daf39df8955c834e9883af046853d95bd579d047e23923a7737560b1b82f021c0773ca500a07f25b029c1697abf6cbd0589ecea2eeed86f986a3ef307abece435d996ef5ad3071fe7f2f5f92e2018ef554983c482dc41aa8dc30816898b4206b8ab8478d782127413bf75c7fd1212e4f8421dfc25d82d9d1dec2fbde742bf1220e9e94884410b0367c16296b4bd203a9381c7a77bb9ebeda16424342c3d8a3d080912034d394e6bee0687d93bc2c172a93cbd03fee8f1cc0843acdd6896100b72d7e03a85d32ef3051f558189d6d319479c40420098d60ed8b2ea8d667acee6afb49dfe8d7d723e42d60a1e815310cec87d57715d5101730894c80283f38d8ec32b70cb78f0f8e71580378bda263ec41ded4ebaa574dbc9286712030ab98e0031715ec694b012a08ada27eda7e1d6bf1cf55674262cb8cffbac87bb40af088cfb5ddc78d8a4717122b8c617509073c2f0f8458ed997ef11c049056b4fd591a697095f455afe997336fea86ed0154e7662dc603226d7d47deb5180a9f78e8d546688fab55fcd0108bf000482b12c379ba3d92723198f294554966ae9e4e05010563f197743158a5cddc4c67655b468fc185c0f8b65f827c1a5085c06bdf1d84a1331bf2fd41fa057e95d90882d8b73c910a0a1dd9932d45529e6106251f83a187868e3684432522992e1a26b9d355365ed0e189e9ec76bdab6664d5bff8976d218625ccce8323bbf217a91b428deef8c69241ed13ed7c251dcd81b024248b29c17d33950a05c91062bec29b2cd8059f6982c21c4b52573521282f08b1b141c9f676446537aba88c86f24194b1c2a465b46b9d7f7aac10f90cd7524ec6f7fb4c8ecb90122b67c33a053e48475940903235c55207beb8a3bf4c55fa16e91e98bad3a50d6916a78551dd336f8c7e2e9d28d6b454ee0509d300848709e1dc0d0553532776abf5650cdaf69da7e702b9c95247b05607c7f1a2fc3cead55db82105092b9bfa60383a306aee56c95f8e054a09ddcb465b77ba133b2aa99a49a7a02463fcd66936d10aebcbbae8431a6a8a82d80ce3d5edfe7dec86def898f59b96f93a2aab5bf59f63bed6d091135fe3df12b7b6594031c2a115e7e2b2d040ca59f0a1d2c3ff759891b74b86ceec3c749f9fe4ab16935fd9011de70522ca991b60eab1ae9e8d76501e19a3cb1df9fbd1d73f0583f88fa619ee0ffadd0ab9d65bba74559a9e2c1c02e00c7554e8ba3ace47b5e53cb381e73b98586f46038c853432096ddc3f907dda5b8352431ef81166b698342a8c251904020b50e2f35ee29abb8f0112bccd335e0264a7083d2eb39948e29153181919b06c4d36048af47f912b1fca6dffec3e3a3d6db22029b23fe5d8425df00cc3f623670b96f191e4de9bc5c36ff6ecada40a99a851b7a7b756f754e109fee83f9e79f640e59fbb4e85eda11ea03fd3e372f1bee87af9118d116d0fad46a67cada92c9aeb5d23794fa98d1f33db27f09ac486f4d9d34febb9c96eca4359da40ec68c9191a67b4abc9e73a1b59b97678f70bf0c9ffb09225ad44a0071cca090de6276d096b64f7ce03ba0eac189594545364029145a85a630593119a4d6e9925351e04656f96d8f5dcf64c78c1c3bf4e17d099ce3e7e5741843ebc7c8ccfbbaa96fc1b17d429236df72d5de7a4d900ab2221987c45df762fd2bebf928c5365782a2509d3ffba8cbf7acbd0f448aff9e535f996e19656714e1631364c2b2ec454c3056f96baee5d25251f09c7d81ecc828b3cf2e20e87bfe9319720c3a691e945ed2374caec0368ba8dbc550fbb1e6202e3105c17f7acfbaf84e1af2ea0746c592bfd3c3e2da0e0a67ff4bf7d3c6a3694a2307d240b42c1d67149aab690fb85132c81553a00dea97b8f2cd0263cfa0788255ded7b030adae7d4f214680aa9b3ffbf3c420fce4ff577ec1fc1a9aac265da02dc9e62d12f6f55303c301b53eca34968d419204f1dc588d5a07ea76cc4d2204bbfedc2c873d63127b197b9eae62eb84eeed69b0413419612238332006183e36a3fba895783780d2ac4cac5b7932a60fd3bf8dfe18516467cb1b75b0639515928f65eb7c1f4a41be2940e857c51614928fb1f1f2eb6c3d6107333eb57402edf4c6c81148a13ca2466e75360633b4ee6ed32a6d71e1932140c08ac01399a0d4f2fb16789613e0faa7074e75acbd9a9c3e9f54dd1d12ee996dbf5a6adc7027209f771fc6374fc2e11f42651f20f28e62d5b7537ef99d182bf9d3ae07bb7821fad332b156920b18ee34641edf4d33ed8bb907346b3f745bfdb61748140062310234a40cf5badbb445bd5bdd938e5680eb7fc5b5336a7b353099e45f3c57bb4858749ecbccf8c8e922123fc3902944c8fc6772284fcf9d7104704e28b2e04913a8db9a2fd37f769e95a13d8815f8c6915b1dc2da591d04ed8aae3473e1948bbf9d6e0e44b602de7d0bd16162a76bc50c9fee874f296ac15ae4ac75e9179b18bed5ca4617f2b9a8d4d3d25cb2f4d1775d50cc56ca8036459d0549433c585b9125ad47f8bdf8981b7c74822cfb9d70dcfe429d143328fa0af4dd155ff8a8d1f558298f16d7dea627ffbef307b9a8c4b7411a17dabae37202e167d51fbd83ca366faf8c3e44278ae1f231c13af0888230867e2fac57079ff722271e41b4462dbe6654697d93c8de0010cf774d57b58767794b749da8def0194df47194ef4c923e12d2cba6ddb0cb47654184d97ddab5e2a7a7fbf7201614567c102277e41948ac00e0bbe4f983c5fba5cb9ca7fe46c5b66990ef71d5b0f08c05bab06c6e6a3cea09eaa93442ccbd2ea3ee69bb5c9161ce52303c1372c634f1026043af040d10a70cc0282950b240f60682a9d29f214b4c22f90feca36466e37f16bfb273c4a6021a65489a58c5d7bb4fef96089d6d98a52c5e51ed8ef2a122eee2751d6dbe05bb8429cd89f50239fa3e025fa9919e237ab0e6d5fca87786baa8633dd716d63a6787c4d06b84e7df9addbcf5d5ec432522c72fc4b68c2ad2477192ea8de446d29ce29c2399e5ff4e3e9c5bd54d2db81567f2c38af9f1b3a7a7aaa37233a07084d093933e96ddb89e46cf4c56ea029ab7b21333117f17fb76038d92aaa45ff786cd571b8b1de2a3480b62fd426e0c19d65f39d531e5981fb745d544cb4342c863a9f02b4bb4cb2c607860e8332269961a8b64a75f0f074a638e19903256514fb4c8bb5cc91a31d4a05854bfdabc6e175b9b9fbff6731296e838263bcd6765f155d086d3bb0d8b28b644e10203de53e394502e3d72b5476b88855b3cd6afa68ef0d3f61f130d8f1a10f5ed5c90256e17f11739e60fd498c58e4c4992ead96fe3e79805d55a1f073016499b73366d03abe27a118ee510e2931c9c8bed7cb99454990b81d63a819da5bfc223631e29848bd7878d9417f90e2e30eb204b54daaae23ce66d230be8fd90f11b33ce0461ac6789142e4fc4ac8114fc9ece7fd2fd52ac6944ac62d4f0eb84327917686af4b36c7cdec60c8ec477bd351e8ab273a6a9a6a4865d64b18c9da2169103116447052631b56cbdd5e8222fb941668761c888fe9d68713ae6bbdd742e6e8272d1fa592d20820d82bd924f6cb8a4c5b3d9da18cb68e63605992a2cc8dddfe416c58907a5c1a87316c2fb28d445049ca192c29d2724fe8404725e0cf59652e411dd02ff9cc682b8a85af143aa639103b0d4076f3ece324a046c6d279217b586cef760ecc69656a45f9a4ba318feb3a76dcf23358961702909fa8962760dab192b55a588b532e20bd30a960145cd5f9ce68bd1a6230538b146e36c94c11df3b458a18aecc2f5463e8cf25a06ba6348a07d479eaf2dd2bc484723482b1cde83607e57fb6c6acf715e69e2e2afb5b05275f9c5e99115703f80c3c9d7ea7e4f0084b5b54e12cc33680f2c85ece26b513656cc4fa34a81ab15e71595ef128663e6fe9888b9fa5755c8f057676056c0699b8340b3a8f47533a8927c03f9b84621712a03c9cc9dda432c15e1c8e6037ee6f5f1508e5ecf0a5a97808efed7495b1a64ed7216e3285348f9e06f0323be4d2bc52f09b8c2a6019e83bb8ad2e1fe8b47561fa8f0ec46eaf4b2b8314e133c2df781938a69870ff94f7deb89a45a8f5eba75a9fe68e55cef56c35b5512443008e04c62589b9298b5f8eff44ca550650b2a6ae0a5d9ce551d669d2ac50d09760909277ad288855801121c3453d8dd23c5465d8400143adcf0af54a2844a5d37d95f96de079a5f6c1c227d7514250ae17aacaef3cc57d0a3201fccc460d396e0f846c20f2def0fdbba32bf2a2d10bacd913a6c187a6fa6005ecaa5bfecdeba9dbec5656cc134a484bb741b7ee8460470c8dec1150733479d77fbdd94a52042d5a571bc20275e50b5936d7777244357b43a7cf79a5ad6d10aa7ad9e4aaf7054b038b26a544877169f79665a5c4511a0f4aba1e7e0d61ae2787ec1f650c52d8a5db004cc1534cd403127195971d41e931ed63ef39b905d10d8410d270fadd1d17bda4d99a0d06c1b78bf896d023fb82f8f5978789a587259fd806168080d9c93e1ddac6b4e52937383f1b4416f60cc741079d2b712f193246fffb20811bc849bc2c1f2f61dd7ab554160e1f95f546f639631f7528a013410409adce7f0e49ffac5ced761a79626bdefa74b632f4258290aa0eeb73ba475d54c92884b1ac2362e597b6606191c491703dda66be870cb4f0ad2a846ffb486976c9d5ca13c95b6388fc63de7866816066020092ec973978ef7a0579ee70a0b306534ecc1bc219765360ea3ac1743b5b085dfc66dd5c152824868d626e13f085892fccd4f33ee6ee63da7c507a9d50137cc3fe265104e39ed3a95f3df6fbdb0ae391e918e6ca1e7c60cb969a2472ae7d7c49159ae25400f56a35368b176d8e4e709c4d9932ac2c63bdfccc9b7945a75a9a0ae2c41da6797ce9860c85f286f38e624d90d938674e133e12b5694b11a3d3980e3e1b663c14b7e335b56d0bcc533752f189308794e060f96188943b8d0a8b3d5bf99d30804dbd55f4fe98a4a8c172597dafeb0301ddc61c3aa7631bcf8202ea9545aaa4f1c51d87af365f7696e9b825ffb0558d08c75eb408e87c5048ee666759107263eb02c94e4f35969232d8b2d43482f11b9c27362387f0593df79cbec5238932a15376edced08274d664402da65cf002fa01846cca6bcf61f354db6e410c16d9ad9a9d0f7a490d6bcdd9eb0e91cec86331f243dbee5962ff9a39dc5a2be6288cb85b321dd78515cb3a51f8ef67e9e61014819f21ee36b988f9ab9161d87f4c2aa1d28902ef0c2e45985b4a0d22d2278de0f969e49719a724bf912a2793b78dd3fe45a01179e2b86a84a1c84a792614aa162cb456cdb5ae1cd640839c739f156d884a14c1bc47a7c49812c583fb11cd59277b9e787ac8bdc275d232ef72de27b73c3bdf9e8cb44f088e734fb42e26ebcc708071582a46655e1ea398a3a864043cb60f4644c0202847bcecf313ef49a09649ab90971a73fd3406782f974557171ae591f773f3fe39c772dc4e28a87532e002df276e494cd9189ee7215a2cd34e6e27a203be1d3fcde048d5bd11d4e759b1ba1d8078a0b8deef9de940ee9e01d49c2ef88c996823cdf7885cfc760c3cee80fe229f35d380bc392b79be80258eda277f4a783d320e8cdb7f6798a57f6bd44ea6e86abfc385c745badb72910bb52126aa72da193a99f46488389230b78102ee3cf92e5ef8d652ff34f46069298789e054dd1e70842c14fd69881890a5379af4cb1f7a2f87c9e9074d188645c5afc2c6ac9983e98feb9e371e69458f3cc421e745cd548b369573b8db236b14527493a56b011145836d5fd0e6f28cc7f8943d77010e6a2d6a13f19dcad154bfa51709f4bbc489b8079b999be1ddb79fac3ebb41504fec64477733f42837559f3442dd1c902b647667a53e67839f3ea69b0013a6dd96b257bc8a05226e2e9395c7a7e948da7f3ee660b51dcea194e5497e2b6c9dca628259a278a123a84a83fdbd380742da5cb692a4eee70e26b50a3fca0363b22db90c439a24a8034ba0fe6acd636eceeca209ee57906569d256dcb505a237f6db3550bc9a4355eb6d47b9c0f10c76fc9dd2d45371171ea5a423bde3af3fdb446acc8ad1b8823aad23308011a1d7e708ff2e6758960eb2601fbdcc45580308fd6e9f734922b39123e9c930646713f847f4198259af499c481f7d5f53fca08241d2da5629ae7c42619f5655ae8c10681709a3306626c89ba6ff42d300608b814ff9658324f3d1c91e5072331353ca97097be1a48645bbf9daf6a975df9c4172da50159ee75ef3d52fcbcf4736137bda29337176ebebb0fceefb8cc25c91149da82b3330bb940b7222b1e2230e6ded81fbb7d76148bc5f21a0c86604a556922732e5be49a3ad4998528cea3b69d340fec38e39a0beb9630a659b16469287e6ef7e9d905addaf22490a6f8acc635ec51c8f564b7aeec96fdb7b67e8be98844d2a593e0dec89602b2f0274cfd7229ce4ae8ff87132a72a68da71a275bc2b4cd019a909e602c0071999b5229c1a2e2d5c9fbb3978dafa3f5e0ddd21c70f71c7ea84f25b179a9f451f861e5ee78220740347404faca3b03a5588d63467234696236cbcc0c5faa163f86110f82374902d3bc53412dcf1425c5af623c238f2aecbc689691ae94379e9001e6a17a01774e826cba987f984a65cb197625e11c972914567508833bfae000f6a3b3448b246a9cb2b0693bed08f735a7e0ab56c5826f47ab336db3b5e490c768248d1bc824fd0dff74b622c77cb161338ee8c9cda29d327bbcfe41dad3430291b107115adc9cab066c0eab77036be653e9d3807ff201667256bd1891b33f9102472fbc1e7f950dd2af69b9a1476235c19e0962f26ba820a588627c392345454f990ff68d90b51c089778a456e3428dfddb37e420aedee9ad916c9b08b53d5ee3c39fd6d53fca7b43fe235d981c5a32988f07ca98d6a4ddccf81fc08cc8f4893d4e6334d15cb747a0fd524e04d9bf5a29e61c192279796c067d39d86b3d768e818af1983090cd46b4a19b7d387dcaf05d08e70a28cbd7efc9cc1bc49cce38f2f9393267bc87d804976cfe02cdf1d3f7cdab0bb838355844d82b9305bafc7a549d6b5ea605ff73343eaa8e04dd5ce7d43753841c0fdd1fabccf415c50b89c80bc655f3223c638ee976f6af43f104cfd71e6b24c8d3bc5e46c7fd95f85c53101d0ff4a60ad6fa20ee450216d70f4d819276ab87a8d801cc0de332edc05de2d184fc749e12db7985dfd928b6db16a120019897d4a8391bf1bf80781857d25257e46b71aa855a2bc8b7b1a3a6ee6bd816d98939ed303cb3301dcc04b190af6ed7b9ebc4a92e8bbab6c9d84cfed9e608d5578763ab81e86229aaa839e89b0d75cb18e1b3c565eb79957fcc9f87660c848340d3d1370508d85cefbbcb612ac6d89f27d07d5ddfc5b63bfafd098ccec36188a4cc28c0dcb71af8c6a5ac462527fd83dba460d0baacc235805f48bc67035a2b9317239a98b21ef52c01dbc339f8ce6ca66fba63d3aac843ba69a1094c8870ada25afd311156fba898a569c2d695c045306f9871ea4216f18dd77cd2f6bdb3272a6c55d1a035ae002bf07032f641ce26d8fa8b61ffa6c406f8ee723850de23f8b2a7dba3f99df0b28e4a94bf817e3010aa35885aff33c4fe06b8840f8b2e3f51924fd4c09b8917aad317d79cb7b6edd2ca15fabef2c1d3f4d96628e28d1ed1535ea4c5738d591036c2eaaacb3fd9c397706cd4496eca591cd1dd9bf0135583a20b7d96181390c669dfed86d6676b2d6afd7ce0809a248dc50c26da9466e0559b0d1401b7e1eb3f4d2c1960dfb78d85df30dd7cac6ce0b5359e079b510b6276716d9a6eee6197124982f001e9e6fd75a7f3c365013155cf13dc102ee96152a5b64c879496de1824cb4e639cf7f60ad76b722f28f3fa6f45e4048c74a241db0339649aeacbfb6cdefed2068651c60ccce4bd6fbd74f6c1c40e659be7302b1ffb43cc49ad4fc85a994c011af52c43fb8db7eb16fc4fa493b51b395170aec251dbe42ea4b3a0a87db63ef64cce66834a80a15eaa5f7f7e6e487339693878d18ded2f6198f304d529c615795204955eb4aa12564f0b4b4757216179ff628f23de5d56ef49c204ab59057a6c90f3e10694f44b3e95db8c5ce5a39fff9dfd48dc89e304305e33338cbf9758214105a90aa0fa2b9eda13caef1c3748d523c1bc2f85cacadb43db95229be5890e8f4883805530240f0d842abe08af89e6b68e18b68367619e07e5ff2505bfa1150f818d2d0a2c75e25a54433fc75c3c011fec28a3fba42ba2711738afa3b8edd1e6f07f4a0917932944db36ed283c83656cba05819a0739a6772dac01caaa3166e8cd28ce4d13f1c28945412abe7bbf12da4da248722cfe8efbeede8693fbdf8d0bcd777d5b8e0b7e8bc485b0ac84af32d870b813c0593e406e482b8e642daa1a772825346ba86a11196a7a79c42985dbdeac7d305378d34e9109b488bbae795937b1c80b0e22ce0c4ff217ce5817b80fd052fda8823b7d1a96e6ec658f7c7f7ab4ac0bb3655556a3af6bba9fbe125d885c66796c936e852c7055fb9950f88d34a7e95e753f5f2fed99ccc0a47918c34bba94f5adf08006645655a37434c381537bbd0ce9e3515508adc85a18684bb23ae85b9fd03616b9df51bdb8b0a8d8f41133d6e8a15cedbb2bf03ffbee9f4ba81c52bc9b29b33a5d5b07f7a638514845e3b8daf51783901ab755494bd6e6bcb41487e4e6da812fcf11bd303ec7bcd503b017cb991eb7ff285066bd04fb60da6de14c3f186087d72de4401e060549587494befcb074b24ff4f6feb5749896b4fa33a904eb3045016c9df6eb2dd5462caca74d160c7b6023c3c6c3fba0250a8962939fe799f530b9a9220577bc596be363e35d01ddda45a511aa36149325f1557170d483d00dbe74cb79219dc4e97c83f11de78dbccbb701599a07afef0e700416721c3c175df618794b644c00f01bd5a84a3b625e0ebdaa26c6c0f8087cc1b1f25f5cf5cae60d138f34e9a89988e4c659e4d53149b9bd107b2b746d22858cababfd2605d78893f63181636c511ad4e2492d364c673aa6ee36168693e4c18b3ce4be391c948b774450d245e6cbccba8f1ff33c0535ff9c12d276397e9ade80b2b89dc43985e1430bf62a84ab4e1b63127b197b9eae62eb84eeed69b0413419612238332006183e36a3fba895783787df62274198c3587cab7a0d937c07eb9ec7a91754663a86246fe6e85eaf91e342466e75360633b4ee6ed32a6d71e1932140c08ac01399a0d4f2fb16789613e0f6842412a30a3a273f661ed15df3c9c05b6dc84b1510a61cc14b2ddf60a9465049689c3a099bc6265aa397eeb63280f85025f22547692bcfac32c128446a9bf98ca361d595e7ab546dadbf4e7733e114627bb3b4c600265bb3c51977d4a118caa0471c07769185ece52caf035cd33c1343c719b70d31f5eaaa4f9a3549c99193f8a18aecc2f5463e8cf25a06ba6348a07d479eaf2dd2bc484723482b1cde836075b54e12cc33680f2c85ece26b513656cc4fa34a81ab15e71595ef128663e6fe9ad6d10aa7ad9e4aaf7054b038b26a544877169f79665a5c4511a0f4aba1e7e0d193246fffb20811bc849bc2c1f2f61dd7ab554160e1f95f546f639631f7528a013410409adce7f0e49ffac5ced761a79626bdefa74b632f4258290aa0eeb73ba475d54c92884b1ac2362e597b6606191c491703dda66be870cb4f0ad2a846ffb3fda512dd8f0e0c3f7860c1ec18442a78c23bf7d8641c7b97b4740103ff1317f71af8c6a5ac462527fd83dba460d0baacc235805f48bc67035a2b9317239a98b8f82940cd9a4722435f6795032b275c478600aa6b2d5712d26f29908007eafb87f4b7b20e6e522a1345735854b32d9b96af21c0be4c45442d194e4a71dd0d33a135d4d63b7a841a921f5c2ddc0c2c38b72286070097883196bd58375bd1674e2b44c95c0e6f5b4e4d8c1996ff71cc0a61e29b92a648d9a50285bd0ed4f9858ab6c132a12e0d436844a4e15ae072acf72191f680dfe0b8a454bbe1b46217ecc9d00a623dc32b6e49d89922d07d4381eb8a9a73e994e17239bf92a8f183367a4bf55e73110c1ead2f7e7e39962dfba2e7fdefc513072fa8b4283e58e3b45ca5d46a26774ec08fcc3e527280332a1b902ca4f2fa0d3dbccf9532c8efa110890debffbd4bbec65eafdd27eea4725c1254cd2955285f2d441238f18451e9c285b72ab7d79da9d5803a663e5fa8282b1a00e82bf5a6dd4ae5e394d2bfc1cd00d3af64edbe75da282f6aa2edd8b1e6258ec094e35f81ae7e60a87783080b464d6d197cdfa7d1584229b65a3d8e5b3a3f0feb1d07b9f78fa274a6cae0f75237af803741f0f2918ab3a99a7a3aa135ff72405043506f297fc8f0d8d4703c5d7e4bdc18ff98d5e0c3c5c40f52fa52e72d91ab097e544ad9145800f0bda01812d3605db2b93408b4a4417d61270faaecd48406ce88e7735ce78c1e4333d0b949803088100efec3777dc1d27bb30c6e6febf0c8d73bbf3e3f88baf3baf43cd6d166f3d0761bbca783f434028f557a65daee345aa7458072334094d901c818b62dee61757fa4b53ea5058cab124854e8ccf98f4f9510d182ae7ce3e457e5549e1b0494f2e6e1cc6e6816c87266a57f764ae908f77323ee3394c3c171e150c1efad7fcb8fcc583c86846ac2375939205ae4ecc4964335fd634d7b1d9bbcc9632c35bd1afc0bd50e229adaae947051392e8478967e1278a57ba93d0faaa466b3d893fba0833aada3df479219142b34613f735d8e889178484cf091d0809e23d33823d28dab7a705ab15fd526bd8dd18a9e77ebc139656bf4d33e97fc7238cd11bf60e2b9b8666c6dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe55155aecc342e4132a0333aa2271fb9a7b785f99e9183c996b74d155a7d6ad8d9942e69972bd2d9961ede9152ee5e2723623427c2b9be6bc5d689a4d11426aa7bd0d286ca1d2cf43cc031fedef889572e49a1c53e61e7fe96d0e24b6d548b8f10ee73fa71815a900524c896d5594639f28d24e9f2ec987d2a7a6fde3989a6c94148dd9a25cbcb3724a7872dbffc225d1995268389088d075539d80ca6fb420f236827ef25267ebfa5188e3b55b76b0419a4deb5b71e826611561752adb44f1c3de70131fdc3d50a62128194b9a6a6d33c3151cfb6b9ba7563f38936760024affb055d16601049c878994454fd3ce9532cd78d5730f635fd5797b8aab0b105ce2ee3ac7c8dcfdebc329b0bf95391e2bf5d0ba8f0e49110f1a7a41f3b42a813e5092f162f6d29acaaf31086047ef3d4a9192d95f7ffd7d19603da9124665570d6ef4b350c0a55d90aea5d7de1a92a677dc2cdc981b7a21f350707fbca13dc5a5ccc0af69bb92c66d67cf20e657e86f03ceec992c64faf263261acea1b5366f6175f3cd038554350ede73e9ce6374eaa7050f7459bbf0b224232ec11b8b04b40ae4da9d39ab563ff3b4c828211bf5bd42c5c9d7e271fb049f200d7645bd35a1c3734065a4372e3f77646540aaf329d1366be0e1c9a4a45de709da835346c02a4aa9f6ab1e7838527c5bfcb8cebdb4cd5f8ddf669e679233639598020412a641c9264b5322396a3a7a1044b20909734bf2b820927b35726c679103a645a1e36a66a9ab39d62d979de8a8d25b126e3a082a60415654c504f1182545e10270596524656ee1fc806411da69e77952fee572e9e62f8eeb8717608c1f7a609c6e52df8bd16b4f1b49b23066b05050d266d74185323b9cb9d59d9fdaa57ef7e911b8eb3f220365c35c8c03814d0a54d02a45048dd5e0903c4672fefeb57c60229196c95c0c44ae96d0cfc5daf671a01ef5faa0fea126a525828042627c8b99c98381d6b7169661a41149207fc5de269ea0dcdeb111e199b4ea77cecf6a7fa6f4b8962377aea147e8bf7e85f4a1c0c53d53c45926ac38a0e69dcb8e2783b11e1d2d3e4310a57b9cdb2a5c6e1da0235027430afaf8279d0edfd00a7b600d8cd9d13b73d1cedbc5ec029606256d31aa951d100a022a94cb2e107c6380997e923fc3f6e2ade72242fd9a1fb7af6246a002f79efc70c6ccef49a8002bfa719be571bb72213d5238df32bd0f845fca5349ef5d9db81912bb79375e0cbfa5959bccf2b134491b2a668c02359ebd383a71e79243ef60ab0f41a53924495a712571ff4761d3a5c2f71a7b55ae09c039a17d0e544d6fc23f7a7751f091a80886557eef4d2983fc27591ba8c5a9821c83c5f910d27f01c0a36c5a749d836ba388729da6dcbc025eef8c8d9ded5be61e1c8f1f733036ca4cc9a834b19a3e907777c4a0af40643e00e9d93140888a236c2d470218ab1b6d8de7b303af62b8f0eb1c8dfa417db9df5db96bc857b258316a43360d85f60d1ffb40a7de7712620873a0c9b6e14ef3155eda9566457bd4ebc6f4f2c538540d0c37d53081035b047ef8f800693fb71389816c6a831ad3e20b299bda4aac05fb2894520fd69abad9cffab09b9fa895cd2689f2de647cd577647bf7a8f87c63b17cb6af39e841e65fdbdfdf952848c10e1c00871659d4aaa91f1a08a72f599cd7157efe6849b513fbeb49e424deb3beb50c28bede425d2df256be45479f419f5671ad5fd99a647017f31a6319b670c72fc2660d5f78c9d4f97e5243c3e429715ac2cbec047c29de0fb48da000a44157b1623fea6a0027e92c2c54972655d41a12670933446847f4fb2376d2d7d9f742928efea60fcdc52c81ea50b06466830c00621c924cb30f47e5910e1ae1d345d9b1eebfa3e5b00f36360add5aa9fcd14e0e95906d1556e15b73ef833be89089cde1c1ef54d3a48df39420b741464d308acf1c57b4625dfaa675e3cc35a02badbcc6a46a3e23a312087c3ff842ca3b9b376e2801c29a297406a7a7c035aaa15da7776f5bfb4dc8fe213b9aa98f0a7ccb52c526545c2150c7ce6a8c21d4be9dae15194273aa11c96394955f850313c1d42ed13bd66738bfbc9a93087890aa657b11ec63953f22712bf7080089b033e2642a151d619cf614fb510437703b5acd2dcd715041c417f22723abe35872138c331985e8001e1718481bb76eca29eb908c64e229dce6bc1ab74eab80c167d2ae87aeb1dd1d35b84ca34c2fa9c2277ca89fd14432aa837ea96b054a81712a181ae6ed292f0f2ae40a3828def8120ee0d4def88fa96df4c4602304df7b457c11fc43c5706bc81cb4f7e5d59abec7d8797cd60309a2106301dac1e383f08ab43aa5f7c5cbd25ec03cc0e57e40d957256bf9dfae869bb4962c23a81aabc02e7ab82288559fe7d7a490aac1311ae8732fffde53b7d0e48eee2dedd010fd11c3aabb0b1b0b9c0e88cb4bbe6c27ade0b455f20d387eb66d567f784181a515d5969205f17e4e6af9f291eba7e31aa90baad2dafdc5c70ed35da7b751e8d34e5dbcaf2cdacbc73e8197da2322862f7fd3ec3b843122fe43852e10bc11f1421d4db8d62b4e293145ca87c22ce85d2959b4741ae3411637af8a4066ac19dd85a99270112cbfab253076fe8abfd83b62caf6d00e85f2623cd158bb8861d114c927142a8ee275f483a9f9479042293f37364a5e3f8cbc1ea03479d3aacaf715ebce1047d1712e7c5f5c5c185e1a0defd1cbd86fdc2a8494978f429eb57c54937/usr/bin/systemctl/usr/lib/systemd/systemd/usr/bin/systemd-ask-password../../systemd/usersystemd-mount/etc/environment/etc/sysctl.confgetty@.servicereboot.targetsystemd-hostnamed.servicesystemd-localed.servicesystemd-logind.servicesystemd-timedated.servicegraphical.target../systemd-remount-fs.service../after-local.service../getty.target../systemd-logind.service../systemd-user-sessions.service../systemd-initctl.socket../systemd-journald-dev-log.socket../systemd-journald.socket../detect-part-label-duplicates.service../dev-hugepages.mount../dev-mqueue.mount../kmod-static-nodes.service../proc-sys-fs-binfmt_misc.automount../sys-fs-fuse-connections.mount../sys-kernel-config.mount../sys-kernel-debug.mount../systemd-ask-password-console.path../systemd-binfmt.service../systemd-firstboot.service../systemd-hwdb-update.service../systemd-journal-catalog-update.service../systemd-journal-flush.service../systemd-journald.service../systemd-machine-id-commit.service../systemd-modules-load.service../systemd-random-seed.service../systemd-sysctl.service../systemd-sysusers.service../systemd-tmpfiles-setup-dev.service../systemd-tmpfiles-setup.service../systemd-update-done.service../systemd-update-utmp.service../systemd-tmpfiles-clean.timer../system-services/org.freedesktop.systemd1.serviceQQQQQQQQQ@@@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsystemd-mini-234-lp150.20.15.1.src.rpmconfig(systemd-mini)libsystemd-shared-234.so()(64bit)pkgconfig(systemd)systemdsystemd-analyzesystemd-minisystemd-mini(aarch-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/usr/bin/pkg-configconfig(systemd-mini)ld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libblkid.so.1()(64bit)libblkid.so.1(BLKID_2.15)(64bit)libblkid.so.1(BLKID_2.17)(64bit)libblkid.so.1(BLKID_2.18)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libcap.so.2()(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.17)(64bit)libkmod.so.2()(64bit)libkmod.so.2(LIBKMOD_5)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libmount.so.1()(64bit)libmount.so.1(MOUNT_2.19)(64bit)libmount.so.1(MOUNT_2.20)(64bit)libmount.so.1(MOUNT_2.26)(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpam.so.0(LIBPAM_EXTENSION_1.0)(64bit)libpam.so.0(LIBPAM_MODUTIL_1.0)(64bit)libpam_misc.so.0()(64bit)libpam_misc.so.0(LIBPAM_MISC_1.0)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libsystemd-shared-234.so()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)this-is-only-for-build-envs234-lp150.20.15.13.0.4-14.6.0-14.0-15.2-1filesystemkiwimkinitrdsystemdsysvinit11.52.7.04.14.1\eX@\eX@\\\Z@\=@\73\5@\5@[[@[ٙ@[[@[[-[~[>@[0@[0@Z@Z@ZnZz@ZZZ@Z3@Z3@ZԐ@ZZZZ2@Z2@ZZ`@Zw@Z%ZZ@Z@Z@Z@Z@ZZ}@Z}@Z}@ZyZyZyZxG@ZxG@ZtRZtRZtRZtRZk@Zk@Zhu@Z]@ZX@ZWQZV@ZDZ7Z3@Z3@Z'Z@Z@Z@Z@Z@Z@Z@YY@YYp@Yp@YY@YA@YA@YA@Yo@Yo@Yo@Yo@Yo@Yo@Yo@YYW@Ym@Y{'@Y{'@YyYx@Yx@Yx@YqY_wY^&@Y^&@Y\YK@YK@YC@Y7Y%uY;@Y;@YR@YtYtYtYtYtYtYtXXXsXg@X@XXZX@XYX@Xe@XpXXX@X@X@X@X@XtXoXn5@Xn5@XWXQ4@XIK@XF@X=mX43@X.@X)@X$a@X$a@X$a@X$a@XXX X X X XX`@XXXXXXXXXXX@X@X@X@X@X@Ww@Ww@WW@W@W@WSW@W@W@W W Wv@WWWίW@W:W@WE@WPW@Ws@We7W)@WKWVyVVVVVaVՄ@V=@V@VS@VwVwVhV`.V\:@VLh@VEVD@VA@V'~@V@V@V@VV@V@VV @V7@V@V@U|@U|@U|@UUoŬUUUȒ@U@U@U@UU@U@Uy@U@U@U@U>U@U@U@UUUUU@Uyx@Uyx@UmUY@UY@UTE@T@T~T~TTTTTC@TTTTp@TTT@T@T@T@TxcTw@Tto@To)@TmTmTl@Tl@Tk4Tk4Td@Td@Td@Td@Ta@T`T`T`T\@TWn@TWn@TR(@TJ?@THTG@TFJTD@T>aT>aT=@T=@T=@T=@T=@T=@T->@T%U@T%U@T$T$T$T"@T"@T"@TTT@TwT&@T&@T&@T&@T1TT @TT@T@T@T_Tk@SS@S@SvSvS0S0SSSSہ@S/S@S@S@S@S@S@S;@SFSFS@S@S@SϣSϣSR@SSSSSǺSǺSi@SSSS@S@SS@S.S.S@S@SSS@S@S@SES@SSSSS\S\S @S @S @SSSSSh@Sh@Sh@SS@S@S-S-S@S@S@SDSDSDSDS@S@S@SS@S[S[S[S[S[SSSSSrS~@S,S,S|@S|@S|@S|@S|@S{CS{CS{CSy@SuSuSsZSr @SpSpSpSj @Sj @Sg}@ScS`S`S^BSW@SO@SO@SNpSM@SKSFSE6@SCS5d@S5d@S1oS1oS0@S)S)S(5@S"@S"@S"@S!S!S L@S L@SSSSSSS@SnSnSnS@S@Sz@Sz@Sz@Sz@Sz@S(S @S S S S?S@R@RRR@R@RmRmR@RR'R3@R@R>R>R@RR@R@Ra@Ra@RR@R@RRx@Rx@R&R1@R1@R@R@R@R@R@R0@R@RRz/@Rw@Rj]@Re@R].@RM\@RL RL RJ@RIgREs@R@-@R@-@R:@R9R9R9R9R6R4OR4OR2@R2@R-@R)RR@QMQY@Q@Qp@QQQֵ@Qֵ@QcQo@Qo@QQQ4Q@@Q@QKQKQQ@QbQ@Q@QQ@QV@QQQxQ'@QQ~`Qzl@QyQvwQvwQu&@QsQq1Qq1Qg@Qg@Qb@QZ@QT0QIQ& @Q#i@Q#i@Q"Q#@Q#@Q@Q.Q @QQh@P@P@P[P @P @PPP7@PPPpPpP@PPP@P@PPoP{@P@P}L@P}L@P{Pmz@P6@Pw@P

A@O8@O3@O1@O'O!@@OOO@O NU@Nǚ@NNGNN$@N@N@N/N/N/NFN@N]N]Ni@N|tNs:@Nm@NiN_sNWNTNNP@NNP@NLNJ[N:N98@N98@N7N6@N2N1O@N%qN MAMMM@MM@M@Mש@Mש@Mש@Mc@M‘@M‘@MMMK@MMVM@Mb@M@M@M~@M{`@MzMzMx@Mv@MtMlMbSMbSMbSM^_@M^_@M] M[@MQ0@MQ0@MK@M:M:M6@M(QM@MM @M @MLs@L@LOLL[@L@LLr@L LLҠ@Lʷ@L@LL@L@LL@LdLp@L*@L5LL@LX@LX@L@LvW@Lnn@LjyLjyLbLa?@L[@L[@LZLZLYV@LV@LJLJLI@LH2LF@LELBL=LFranck Bui Franck Bui Franck Bui Franck Bui Franck Bui Franck Bui Franck Bui Franck Bui Lee, Chun-Yi Franck Bui Franck Bui fbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comjlee@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comThomas.Blume@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comrbrown@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comkukuk@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comjengelh@inai.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comkukuk@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.commeissner@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comtbechtold@suse.comdimstar@opensuse.orgfbui@suse.commeissner@suse.comjengelh@inai.dejengelh@inai.dedevelop7@develop7.infoasarai@suse.comarvidjaar@gmail.comThomas.Blume@suse.comschwab@suse.dewerner@suse.dejengelh@inai.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comwerner@suse.dewerner@suse.delnussel@suse.deafaerber@suse.deolaf@aepfle.defbui@suse.comjengelh@inai.decrrodriguez@opensuse.orgtchvatal@suse.comthomas.blume@suse.comjengelh@inai.desor.alexei@meowr.ruwerner@suse.deschwab@suse.dedmueller@suse.comfbui@suse.comjengelh@inai.dewerner@suse.defbui@suse.comfbui@suse.comfbui@suse.comwerner@suse.dejengelh@inai.dewerner@suse.dejengelh@inai.dewerner@suse.dewerner@suse.defbui@suse.comwerner@suse.defbui@suse.comfbui@suse.comwerner@suse.dejengelh@inai.dejengelh@inai.desndirsch@suse.commeissner@suse.comwerner@suse.dejengelh@inai.decrrodriguez@opensuse.orgjengelh@inai.dehrvoje.senjan@gmail.comwerner@suse.dejengelh@inai.decrrodriguez@opensuse.orgcrrodriguez@opensuse.orgsbrabec@suse.comcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orghrvoje.senjan@gmail.commpluskal@suse.comjengelh@inai.dewerner@suse.dewerner@suse.depwieczorkiewicz@suse.comwerner@suse.dejengelh@inai.dewerner@suse.dejengelh@inai.dejengelh@inai.demeissner@suse.comcrrodriguez@opensuse.orgjengelh@inai.dejengelh@inai.dejengelh@inai.demeissner@suse.comwerner@suse.dejengelh@inai.dearvidjaar@gmail.comwerner@suse.dethomas.blume@suse.comthomas.blume@suse.comwerner@suse.dewerner@suse.dethomas.blume@suse.comwerner@suse.dewerner@suse.dermilasan@suse.comrmilasan@suse.comrmilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.degber@opensuse.orgLed werner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dermilasan@suse.comthomas.blume@suse.comgber@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.delduncan@suse.comwerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comrmilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decrrodriguez@opensuse.orgwerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dermilasan@suse.comjeffm@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.defcrozat@suse.comwerner@suse.dermilasan@suse.comrmilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dermilasan@suse.comwerner@suse.dejlee@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.demeissner@suse.comwerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dearvidjaar@gmail.comwerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dejlee@suse.comcrrodriguez@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decrrodriguez@opensuse.orgsndirsch@suse.comwerner@suse.dewerner@suse.dermilasan@suse.comrmilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.deoneukum@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dethomas.blume@suse.comcoolo@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.deschwab@linux-m68k.orgwerner@suse.dewerner@suse.dewerner@suse.dehrvoje.senjan@gmail.comwerner@suse.dewerner@suse.dehare@suse.dewerner@suse.dewerner@suse.dewerner@suse.dethomas.blume@suse.comwerner@suse.dewerner@suse.dero@suse.dero@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.destefan.bruens@rwth-aachen.destefan.bruens@rwth-aachen.destefan.bruens@rwth-aachen.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comcoolo@suse.comwerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comcoolo@suse.comwerner@suse.dewerner@suse.deohering@suse.comwerner@suse.dewerner@suse.dewerner@suse.dearvidjaar@gmail.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.defcrozat@suse.comwerner@suse.dewerner@suse.delnussel@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.delbsousajr@gmail.comhrvoje.senjan@gmail.comlbsousajr@gmail.comfcrozat@suse.comwerner@suse.dearvidjaar@gmail.comlbsousajr@gmail.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.defcrozat@suse.comfcrozat@suse.comhrvoje.senjan@gmail.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comarvidjaar@gmail.comfcrozat@suse.comfcrozat@suse.comcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgfcrozat@suse.comcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgfcrozat@suse.comcrrodriguez@opensuse.orgfcrozat@suse.comfcrozat@suse.comidonmez@suse.comlnussel@suse.defcrozat@suse.comfcrozat@suse.comfcrozat@suse.comcrrodriguez@opensuse.orgarvidjaar@gmail.commls@suse.decrrodriguez@opensuse.orgcrrodriguez@opensuse.orgfcrozat@suse.comfcrozat@suse.comcoolo@suse.comrmilasan@suse.comrmilasan@suse.comcrrodriguez@opensuse.orgrmilasan@suse.commhrusecky@suse.commhrusecky@suse.comcrrodriguez@opensuse.orgjengelh@inai.desbrabec@suse.czfcrozat@suse.comrmilasan@suse.comcrrodriguez@opensuse.orgfcrozat@suse.comcrrodriguez@opensuse.orgfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comrmilasan@suse.comdschung@cs.uni-kl.defcrozat@suse.comrmilasan@suse.comfcrozat@suse.comcoolo@suse.comfcrozat@suse.comcrrodriguez@opensuse.orgfcrozat@suse.commax@suse.comfcrozat@suse.comrschweikert@suse.comfcrozat@suse.comsbrabec@suse.czrmilasan@suse.comrmilasan@suse.comfcrozat@suse.comfcrozat@suse.comrmilasan@suse.comjengelh@inai.defcrozat@suse.comlnussel@suse.dermilasan@suse.comrmilasan@suse.comfcrozat@suse.comrmilasan@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comrmilasan@suse.comrmilasan@suse.comcrrodriguez@opensuse.orgcoolo@suse.comcrrodriguez@opensuse.orgfcrozat@suse.comfcrozat@suse.comrmilasan@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comcoolo@suse.comfcrozat@suse.comcoolo@suse.comcoolo@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comsbrabec@suse.czfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comsbrabec@suse.czfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comsbrabec@suse.czfcrozat@suse.comdvaleev@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comjengelh@medozas.detittiatcoke@gmail.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comtittiatcoke@gmail.comtittiatcoke@gmail.comfcrozat@suse.comfcrozat@suse.comcoolo@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comcoolo@suse.comcoolo@suse.comcoolo@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@suse.comfcrozat@novell.comfcrozat@suse.comfcrozat@novell.comfcrozat@suse.comfcrozat@suse.comaj@suse.defcrozat@suse.comfcrozat@suse.comfcrozat@suse.comaj@suse.defcrozat@suse.comaj@suse.deaj@suse.deaj@suse.deaj@suse.defcrozat@suse.comfcrozat@novell.comsaschpe@suse.dekay.sievers@novell.comfcrozat@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comcoolo@opensuse.orgmeissner@suse.dekay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comcoolo@novell.comwerner@suse.dekay.sievers@novell.comkay.sievers@novell.comjeffm@suse.dejeffm@suse.dekay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comjeffm@suse.dekay.sievers@novell.comkay.sievers@novell.comseife@opensuse.orgkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comaj@suse.dekay.sievers@novell.comaj@suse.dekay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.comkay.sievers@novell.com- Add 0001-systemd-PID1-crash-with-specially-crafted-D-Bus-mess.patch (bsc#1125352 CVE-2019-6454)- Import commit 98de7a2368c96c3914bca239b35d5b1de6bffcc2 434d2010d0 sd-bus: if we receive an invalid dbus message, ignore and proceeed 0cbdb75339 automount: don't pass non-blocking pipe to kernel.- Import commit 7902374f4046d3515973c2292fe764967cfc2309 b808bd8f67 units: make sure initrd-cleanup.service terminates before switching to rootfs (bsc#1123333) 58a5ac4cca logind: fix bad error propagation fb118b996e login: log session state "closing" (as well as New/Removed) e0065eec98 logind: fix borked r check 4a978123cd login: don't remove all devices from PID1 when only one was removed c7af85fa55 login: we only allow opening character devices d21d3f32d1 login: correct comment in session_device_free() a5c15fde73 login: remember that fds received from PID1 need to be removed eventually 12ed3e765a login: fix FDNAME in call to sd_pid_notify_with_fds() d16ea1c77a logind: fd 0 is a valid fd 06546129b3 logind: rework sd_eviocrevoke() 5b40830fcb logind: check file is device node before using .st_rdev 5d69862a26 logind: use the new FDSTOREREMOVE=1 sd_notify() message (bsc#1124153) 6b10a71597 core: add a new sd_notify() message for removing fds from the FD store again 767e6baa0e logind: make sure we don't trip up on half-initialized session devices (bsc#1123727) 95828c00c4 fd-util: accept that kcmp might fail with EPERM/EACCES c1448fc331 core: Fix use after free case in load_from_path() (bsc#1121563)- Import commit 72e2d92e01b6e4686e6ac0b9cea391eb2ad4bc02 fc4e41ca9e core: include Found state in device dumps 8f795776b1 device: fix serialization and deserialization of DeviceFound 2af4971594 fix path in btrfs rule (#6844) f8ac04cffb assemble multidevice btrfs volumes without external tools (#6607) (bsc#1117025) c96249b50c Update systemd-system.conf.xml (bsc#1122000) 37245007a7 units: inform user that the default target is started after exiting from rescue or emergency mode- Import commit 9874ecb0457fd43cdde01085a878acdf2fa5af36 96313ee86a pull: initialize libgcrypt before calling any functions provided by libgcrypt 08870024dc hwdb: remove stray 'i' in hwdb match string for the HP Spectre (#9571) f09d3f3648 cryptsetup: Add dependency on loopback setup to generated units 3dfe6375a9 journal-gateway: use localStorage["cursor"] only when it has valid value 44af6bc697 journal-gateway: explicitly declare local variables a780ac41ce analyze: actually select longest activated-time of services f57d448ff8 sd-bus: fix implicit downcast of bitfield reported by LGTM 02e8443486 install: fix error handling in is_symlink_with_known_name() 5d4d445912 resolve: fix return value type of dns_answer_has_dname_for_cname() 4bfb5d31d5 resolve: dns_scope_network_good() does not returns negative errno c7028bd00a core: free lines after reading them (bsc#1123892) 63b4e1c44b pam_systemd: reword message about not creating a session (boo#1111498) 7811bf8e80 pam_systemd: suppress LOG_DEBUG log messages if debugging is off (boo#1111498)- Import commit b3fe3bed57dbf0a8c280caa4b45323e689f683e2 e3666c6e3e journal-remote: set a limit on the number of fields in a message (CVE-2018-16865 bsc#1120323) a6d9216e7a journal-remote: verify entry length from header 6d319eb61e journald: set a limit on the number of fields (1k) (CVE-2018-16865 bsc#1120323) f9c666991a coredump: fix message when we fail to save a journald coredump 2ad2d953c7 journald: do not store the iovec entry for process commandline on stack (bsc#1120323 CVE-2018-16864) 10f19f0bbf journald: remove unnecessary {} eec4fdb05c coredump: remove duplicate MESSAGE= prefix from message- Import commit 8f7529bfb001e99ebaab8f50d611ab750b96917d (CVE-2018-6954 bsc#1080919) 61043b6fd3 Add macro for checking if some flags are set c15f0a33a2 test: Run qemu/nspawn tests with "set -e" 2c818c539a test: Factorize common integration test functions (#6540) aa07d4eef4 test: Write state and log files into $BUILD_DIR 0207cea661 tmpfiles: fold five lines into two 9b622de3ad tmpfiles: "e" takes globs 2f1f321b26 tmpfiles: don't adjust qgroups on existing subvolumes (bsc#1093753) 32bc657d2b tmpfiles: use fd_get_path() even less excessively c0a4ee798f test: make TEST-22 easier to debug, by outputting to /dev/console 4e6c4d3147 test: don't use "nobody:nogroup" for tests 1c22e03b53 tmpfiles: return correct error variable after fd_reopen() 3147f8b81b tmpfiles: reindent one comment less weirdly 52c5e3dcce tmpfiles: use correct error variable 34395ac640 tmpfiles: clarify that we ignore file attribute setting errors 2e68b99078 tmpfiles: add log message where we previously failed silently 4b4025ebf4 tmpfiles: use fd_get_path() less excessively f004d24b2a tmpfiles: add more tests a516490b24 test: don't send image building output to /dev/null (#8886) d827068b53 tmpfiles: don't follow unsafe transitions in path_set_*() f38c092871 fs-util: add new CHASE_NOFOLLOW flag to chase_symlinks() 0fd2349ec9 tmpfiles: make create_fifo() safe 0c40e5f0fd fs-util: introduce mkfifoat_atomic() helper cfaa792ef9 fileio: make tempfn_random_child() accept empty string as path 842dcb66f7 tmpfiles: introduce create_fifo() 37aac5922d tmpfiles: introduce empty_directory() a3ee4deb69 tmpfiles: introduce create_directory() and create_subvolume() and make them safe c46af42ca2 basic/stat-util: introduce is_dir_fd() 15c9a82bce btrfs-util: unfuck tmpfiles' subvol creation 56728ebf2c btrfs-util: introduce btrfs_subvol_make_fd() 6c125e3be7 basic/label: introduce mkdirat_label()/mkdirat_errno_wrapper() helpers 18fe67c959 selinux: introduce mac_selinux_create_file_prepare_at() 1b711db4b6 path-util: introduce new safe_getcwd() wrapper d770b8db30 smack: introduce mac_smack_fix_at() 0ffb1013bc smack: make mac_smack_fix() deal somewhat sensible with non-absolute paths 55e7a0cd2a Fix compilation w/o smack (#8593) 84e8ac537b label: rework label_fix() implementations (#8583) 3686673f0a tmpfiles: introduce create_directory_or_subvolume() 1a2573fadf tmpfiles: make create_device() safe 5c9a660957 tmpfiles: introduce create_device() c177df34c8 tmpfiles: make copy_files() safe 06a5290c63 tmpfiles: introduce copy_files() routine 6d641c23a8 tmpfiles: make write_one_file() safe 1782e90f3d tmpfiles: make truncate_file() safe 5101dfbff7 tmpfiles: introduce truncate_file() which deals with 'F' exclusively 1886d7636f tmpfiles: introduce create_file() which deals with 'f'/'F' exclusively c7f0d990b5 tmpfiles: make the stat struct parameter in fd_set_*() optional 04ce630755 tmpfiles: stat file in item_do() rather than in its callers 04883c43b7 tmpfiles: set only default acls to folders #9545 (#9599) e6720dda59 tree-wide: some O_NDELAY → O_NONBLOCK fixes 8f2444bccd tmpfiles: fix up and complain paths referring to /var/run (instead of /run) automatically 92cafeb3ab tmpfiles: 'e' is supposed to accept shell-style globs 0ad95b0f9a tmpfiles: 'e' is supposed to operate on directory only a1ba1e298b fs-util: introduce fchmod_opath() 6774858c3e tmpfiles: remove spurious curly braces in create_item() ff7b2a2149 tmpfiles: create parent directories if they are missing for more line types 4d225f603f fd-util: introduce fd_reopen() helper for reopening an fd bcec6544d6 test: add tests for systemd-tmpfiles 281d06a8fa tmpfiles: don't resolve pathnames when traversing recursively through directory trees 69a3a957d4 tmpfiles: fstat() works with fd opened with O_PATH since Linux 3.6 5e2146a435 tmpfiles: make hardlink_vulnerable() argument constant f871a58fe7 tmpfiles: make "f" lines behaviour match what the documentation says 3583d83776 tmpfiles: shortcut path_set_perms() if there's nothing to do 465416b058 tmpfiles: fix check for figuring out whether to call chmod() baf3ea541c tmpfiles: avoid using wrong type for strlen() result a8d6590e17 basic/fs-util: remove logically dead code 3768f894ed fs-util: add new CHASE_STEP flag to chase_symlinks() cd09a3129d macro: introduce new TAKE_FD() macro 0feee55455 macro: introduce TAKE_PTR() macro 58987f02cb fs-util: add shortcut for chase_symlinks() when it is called like open(O_PATH) 662fe953fb fs-util: chase_symlinks(): support empty root accfcc9d5c fs-util: refuse taking a relative path to chase if "root" is specified and CHASE_PREFIX_ROOT is set 6caab72812 fs-util: extra chase_symlink() safety check on "path" parameter 996c2c2fa6 fs-util: extra safety checks on chase_symlinks() root parameter 1252ee00da fs-util: remove comment about non-existing function b42e2bb5f9 nspawn: make sure we don't leak the fd in chase_symlinks_and_update 41fff37ee3 fs-util: add new chase_symlinks() flag CHASE_OPEN 67f388cc93 user-util: add UID_NOBODY defines that resolve to (uid_t) 65534 4b036c36a1 fs-util: use _cleanup_close_ attribute 0390eb2077 fs-util: chase_symlinks(): prevent double free 4c495215e3 fs-util: add new CHASE_SAFE flag to chase_symlinks() 9242f48c29 fs-util: chase_symlinks(): remove unnecessary slash at the head 17ae72b9b0 Move mkdir_label() to mkdir-label.c 581192d868 Move selinux-related stuff from btrfs-util.c to label.c 008a35deb6 Add mkdir_errno_wrapper() and use instead of mkdir() in various places fa77d89b43 mkdir: introduce follow_symlink flag to mkdir_safe{,_label}() b8c314823d mkdir: chmod_and_chown() returns errors as "return -errno", not in errno itself e9231b19eb tmpfiles: check if not too many symbolic links. (#7423) 48a7365e7f tmpfiles: with "e" don't attempt to set permissions when file doesn't exist (#6682) ad2c7f6a04 basic/macros: add STRLEN() to get length of string literal as constant expression- Import commit c7f08cbe22b95d97a0eea4832991c8390cc86866 c152c950d4 vconsole-setup: fonts copy will fail if the current terminal is in graphical mode (bsc#1114933) 827dc868bd 6647 - use path_startswith("/dev") in cryptsetup (#6732) (bsc#1119971) 5d1e170e05 logind: stop managing VT switches if no sessions are registered on that VT (bsc#1101591) 07fc858f25 terminal-util: introduce vt_release() helper eee33c6e5d terminal-util: introduce vt_restore() helper a133c368a4 terminal: unify code for resetting kbd utf8 mode a bit (#6692) 2a487a79ea terminal reset should honour default_utf8 kernel setting (#6606) a33d12fd73 logind: make session_restore_vt() static ef799fb7ec udev/net-id: check all snprintf return values 46343b3248 core: don't include libmount.h in a header file (#8580) 2763be9d36 udev: downgrade message when we fail to set inotify watch up (bsc#1005023) f66ba2d179 namespace: always use a root directory when setting up namespace (bsc#1045723) 98d173e12e core: ReadWritePaths= and friends assume '+' prefix when BindPaths= or freinds are set 5d581cee2f namespace: properly handle bind mounts from the host 7b0b2e418b namespace: create /dev, /proc, /sys when needed 84736215a4 coredump: only install coredump.conf when ENABLED_COREDUMP=true- Fix the test for figuring out if /etc/machine-id is writable in %post (bsc#1117063) "test -w" always returns true for root user even if the writable mode bits are not set. Fix this by testing the file mode bit value instead.- udev: ignore the exit code of systemd-detect-virt for memory hot-add (bsc#1076696) In 80-hotplug-cpu-mem.rules on SLE12-SP3, there have a memory hot-add rule uses systemd-detect-virt to detect non-zvm environment. The systemd-detect-virt returns exit failure code when it detected _none_ state. The exit failure code causes that the hot-add memory block can not be set to online. See: https://www.spinics.net/lists/systemd-devel/msg00341.html- Import commit ceefdbf8afbc95dc2728999ce0cd7493411357e4 43b790123 dhcp6: make sure we have enough space for the DHCP6 option header (bsc#1113632 CVE-2018-15688) 96eba195c dhcp6: split assert_return() to be more debuggable when hit 38c94b4bf core: skip unit deserialization and move to the next one when unit_deserialize() fails ef058a4f9 core: when deserializing state always use read_line(…, LONG_LINE_MAX, …) (bsc#1113665 CVE-2018-15686) 5581cd610 core: properly handle deserialization of unknown unit types (#6476) e2933aa92 core: don't create Requires for workdir if "missing ok" (bsc#1113083) 794443b1c logind: use manager_get_user_by_pid() where appropriate 986d63b00 logind: rework manager_get_{user|session}_by_pid() a bit 83d0f831e login: fix user@.service case, so we don't allow nested sessions (#8051) (bsc#1112024) f2a73744c core: be more defensive if we can't determine per-connection socket peer (#7329) fc9172ff8 core: introduce systemd.early_core_pattern= kernel cmdline option cd2ed8f59 core: add missing 'continue' statement c6c6cc19c core/mount: fstype may be NULL 1da4c5dd4 journald: don't ship systemd-journald-audit.socket (bsc#1109252) 7bb6768b3 core: make "tmpfs" dependencies on swapfs a "default" dep, not an "implicit" (bsc#1110445) 5aa2ccd69 mount: make sure we unmount tmpfs mounts before we deactivate swaps (#7076) 57cc22fef detect-virt: do not try to read all of /proc/cpuinfo (bsc#1109197) 3c4503ec6 emergency: make sure console password agents don't interfere with the emergency shell 7a1eb19d7 man: document that 'nofail' also has an effect on ordering e0326fc41 journald: take leading spaces into account in syslog_parse_identifier a09b1acab journal: do not remove multiple spaces after identifier in syslog message e7a85abe6 syslog: fix segfault in syslog_parse_priority() 6d66aca0f journal: fix syslog_parse_identifier() be15909f3 install: drop left-over debug message (#6913)- Ship systemd-sysv-install helper via the main package This script was part of systemd-sysvinit sub-package but it was wrong since systemd-sysv-install is a script used to redirect enable/disable operations to chkconfig when the unit targets are sysv init scripts. Therefore it's never been a SySV init tool.- Import commit 5da416950ebe9c4d834ffb8382b0dcaee1941aa8 9d0d3c2bb tmpfiles: don't adjust qgroups on existing subvolumes (bsc#1093753) 828198433 socket-util: attempt SO_RCVBUFFORCE/SO_SNDBUFFORCE only if SO_RCVBUF/SO_SNDBUF fails (bsc#991901) 043f75c0d user@.service: don't kill user manager at runlevel switch (bsc#1091677) 21eae45f7 units: make sure user@.service runs with dbus still up 27f607ce7 fix race between daemon-reload and other commands (v234) (bsc#1105031) 83126307c nspawn: always use mode 555 for /sys (bsc#1107640) 8a77eed0a cryptsetup: do not define arg_sector_size if libgcrypt is v1.x (#9990) 7ebb0643c cryptsetup: add support for sector-size= option (#9936) (fate#325697)- Enable or disable machines.target according to the presets (bsc#1107941) Enable or disable machines.target according to the distro's presets.- Import commit f26a4b03baf10f479951bdffa0f70eff6b5451c1 5af898dfe core/service: rework the hold-off time over message a4aa80162 systemctl: load unit if needed in "systemctl is-active" (bsc#1102908) 72f8ae153 core: don't freeze OnCalendar= timer units when the clock goes back a lot (bsc#1090944) ed49f225e man: SystemMaxUse= clarification in journald.conf(5) (bnc#1101040) c47c1fd5e core: in --user mode, report READY=1 as soon as basic.target is reached (#7102) ee9d1567c sd-bus: extend D-Bus authentication timeout considerably (#6813)- Add 0002-udev-optionally-disable-the-generation-of-the-partla.patch (bsc#1089761) This patch adds "udev.no-partlabel-links" kernel command-line option that can be used to disable the generation of the by-partlabel symlinks regardless of the name used. This might be useful to prevent the generation of such symlinks on big setups where it could have a bad impact on the performance of the boot process. This will allow user to workaround bsc#1089761 whatever the partlabel used for disks (previous patch was only dealing with "primary" and "logical" names). DISCLAIMER: this new option must be used to workaround the previous bug *only* as it will be dropped as soon as the udev perf issue will be addressed.- Import commit 2bf8d0f79760dd75bc221f9e91d294e4957e6c95 181ae456a udev: use MAC address match only for ibmveth/ibmvnic/mlx4 (bsc#1095096) 5a1aa8454 compat-rules: generate more compat by-id symlinks for NVMe devices (bsc#1095096)- Import commit 455f9b8841be896cb9a46a76f441a68a54187b29 be5d72795 systemctl: mask always reports the same unit names when different unknown units are passed (bsc#1095973) d484e8167 systemctl: check existence of all units, not just the first one b33745be7 scsi_id: Fixup prefix for pre-SPC inquiry reply (bsc#1039099) f141e98a0 device: make sure to always retroactively start device dependencies (take #2) (bsc#1088052) cc7cfdc06 locale-util: on overlayfs FTW_MOUNT causes nftw(3) to not list *any* files c10206dad Fix pattern to detect distribution 7b8f97e93 basic/macros: rename noreturn into _noreturn_ (#8456) f4836f05a install: "user" and "global" scopes are equivalent for user presets (boo#1093851) 8f3fb5638 install: search preset files in /run (#7715) e871d6192 install: consider globally enabled units as "enabled" for the user (bsc#1093851) a25169127 install: consider non-Alias=/non-DefaultInstance= symlinks as "indirect" enablement c4635e551 install: only consider names in Alias= as "enabling" 1b78301a5 install: move and rename to lowercase two functions e79156aee udev: whitelist mlx4_core locally-administered MAC addresses in the persistent rule generator (bsc#1083158) 6c565351b man: updated systemd-analyze blame description for service-units with Type=simple (#8834) (bsc#1091265) 380e80633 fileio.c: fix incorrect mtime 0ae375c66 fileio: support writing atomic files with timestamp- Drop runtime dependency on dracut (bsc#1098569) Otherwise systemd pulls in tools to generate the initrd even in container/chroot installations that don't have a kernel anyways. For environments where initrd matters, dracut should be pulled via a pattern.- Import commit d5dfab21f033c8af518e169a4cc79365a26974e2 e79156aee udev: whitelist mlx4_core locally-administered MAC addresses in the persistent rule generator (bsc#1083158)- Disable user services by default (bsc#1090785)- Add 0001-udev-don-t-create-by-partlabel-primary-and-.-logical.patch (bsc#1089761)- Make sure /etc/machine-id has correct permissions (boo#1092269) This should be only needed for those who keep a Beta/RC installations.- Move 80-container-v[ez].network in systemd-container sub-package - Move 80-container-host0.network from udev to systemd- Import commit d5dfab21f033c8af518e169a4cc79365a26974e2 92bf37b0a device: skip deserialization of device units when udevd is not running 0a8984996 device: make sure to always retroactively start device dependencies (bsc#1088052) 88df88129 cryptsetup-generator: do not bind to the decrypted device unit (#6538) (bsc#1089693)- Ship 99-sysctl.conf instead of creating it during package installation/update (bsc#1088769) Previously this symlink was created in /etc/sysctl.d during %post which made the symlink not owned and more importantly it was created only if /etc/sysctl.conf is already installed which is not always the case during the installation process it seems. So ship the symlink unconditionally and put it in /usr/lib/sysctl.d instead since it's a distro default behavior that might be overriden by sysadmin later.- Import commit 9c35953dd19e90e4bfb03ad41380f3a5f9ae3ce7 a374ad328 Drop busname unit type (bsc#1089376) 85a01da56 shared/dissect-image: adapt to LUKS2 format a0ac1823c dissect: add a bit of debug logging if dm-crypt fails on us 386ae68a0 cryptsetup: support LUKS2 on-disk format (bsc#1083571) 5f3b66fdb systemd-udevd: limit children-max by available memory (#8668) (bsc#1086785 bsc#1066422) 54833e3ab tmpfiles: fix directory removal with force symlink (#8619) 04ef8e535 rules: fix syntax inconsistency in 75-persistent-net-generator.rules spotted by rule syntax checker- Drop dangling symlinks when systemd-container is not installed (bsc#1089376) - /usr/lib/systemd/system/remote-fs.target.wants/var-lib-machines.mount symlink is now part of systemd-container. - Dangling org.freedesktop.*.busname symlinks have been dropped completely and the support of busname has been removed from the git repo since it was dead code (kdbus was rejected).- systemd: add offline environmental condition to 80-acpi-container-hotplug.rules (bsc#1082485) Add the offline event environmental condition to restrict the rule that is can only be triggered when the change event is received with the "offline" environmental data. The 27664c581 "ACPI / scan: Send change uevent with offine environmental data" kernel patch changed the corresponding code in kernel. This change prevents the udev rules for acpi container be triggered by "udevadm trigger" from user space.- Split systemd-coredump sub-package off (bsc#1083849)- Rename the tarball to reflect the exact version used (bsc#1087323) So it's clear that it contains some additional patches on top of the upstream version. Use the commit hash in the name so the exact version can easily be identified. Provide _service file which can be used to retrieve the tarball from the git repo (with "osc service disabledrun").- Import commit b83c42d5d91a5ace2b4aa7420e83c98292e6f9e3 a59988ee5 sysusers: make sure to reset errno before calling fget*ent() 98ddbf6b3 sysusers: also add support for NIS entries in /etc/shadow 586c08f63 sysusers: do not append entries after the NIS ones (bsc#1085062 bsc#1045092) 3993df26a compat-rules: fix error detected by the rule syntax checker- Don't ship machines.target in systemd-container but in systemd main package machines.target is supposed to be a standard target for starting/stopping all containers. systemd-nspawn is the main user of it but other container managers could also make use of it.- Create systemd-container-mini package So we don't have to manually track and remove all files that should be shipped by systemd-container in the case of a bootstrap build.- Run migrate-sysconfig-i18n.sh also during package installation (bsc#1086164) This is needed when we upgrade from SLE11.- Split systemd-container sub-package off (fate#325469) This split off has been in Factory/TW since a couple of weeks now without any reported problems and I think it makes also sense to have it in SLE.- Import commit 6efb938f152b60c905b8496980697400b13e02a7 06d5d0701 rules: maintain 80-hotplug-cpu-mem.rules in the package 01db63eeb rule-syntax-check: allow commas inside quoted strings 8247f6155 rule-syntax-check: add support for escaped double quotes a6354c05b rule-syntax-check: values can contain escaped double quotes 5c8d9a358 rule-syntax-check: PROGRAM is not supposed to get value assigned 88174ae85 compat-rules: fix syntax errors spotted by test/rule-syntax-check.py f4f94ab2e meson: install rules/80-hotplug-cpu-mem.rules 2901aa9b9 meson: install rules/60-ssd-scheduler.rules db1d8eacd compat-rules: make path_id_compat build with meson- Fix hotplug memory in 80-hotplug-cpu-mem.rules Drop broken script udev-remount-tmpfs. When new memory was hotplugged, the rule was supposed to call the external script (udev-remount-tmpfs) to remount all tmpfs. However the script was broken since its introduction (commit rev=715, 14/07/2014) and had no effects... this makes me wonder if we shouldn't get rid of this... The logic is now embedded in the rule file.- Add basic user space support for suspend to idle (fate#323814) Add 99-wakeup-from-idle.rules Currently this only covers the power button and usb/AT keyboards as wakeup devices. It is planned to make that configurable in the future.- Add dmi conditions to 80-acpi-container-hotplug.rules (bsc#1078358, bsc#1081170, bsc#1075743) Patch sent by Lee, Chun-Yi to @systemd-maintainers. http://mailman.suse.de/mailman/private/systemd-maintainers/2018-February/032177.html Commit message: Add dmi/id conditions to 80-acpi-container-hotplug.rules to restrict the rule that it can only be triggered on Huawei Kunlun 9008, 9016 and 9032 machines. (bsc#1078358, bsc#1081170, bsc#1075743)- Re-enable systemd-firstboot It's used by the installer and also by JeOS.- Import commit 0987985db5a5797db8dc708e67166d329fa74858 1293c0056 core: use id unit when retrieving unit file state (#8038) (bsc#1075801) 596b2b241 Revert "vconsole-setup: add SUSE specific settings for font/keyboard in sysconfig" 0b595da04 Revert "locale-setup: handle locale at boot time well" 2a181fc6f insserv-generator: make it build with meson 7b0401da4 build-sys: don't build networkctl if networkd is disabled b1e0a348d fileio: include sys/mman.h f1fa784cb meson: update header file to detect memfd_create() 8838ba7ec meson: define _GNU_SOURCE to detect copy_file_range() (#7734)- Disable systemd-firstboot I don't think there's any use case for it currently.- Drop unused code dealing with tmp.mount Commit "Don't ship /usr/lib/systemd/system/tmp.mnt at all (bsc#1071224)" forgot to delete this chunk of code which is no more needed.- Make systemd-timesyncd use the openSUSE NTP servers by default Previously systemd-timesyncd used the Google Public NTP servers time{1..4}.google.com- Drop 0001-Revert-locale-setup-handle-locale-at-boot-time-well.patch 0002-Revert-vconsole-setup-add-SUSE-specific-settings-for.patch These 2 patches have been merged in branch "SUSE/v234"- Don't ship /usr/lib/systemd/system/tmp.mnt at all (bsc#1071224) But we still ship a copy in /usr/share/systemd. Users who want to use tmpfs on /tmp are supposed to add a symlink in /etc/ pointing to the copy shipped in /usr/share. To support the update path we automatically create the symlink if tmp.mount in use is located in /usr/lib.- Enable systemd-networkd on Leap distros only (bsc#1071311)- Don't build seccomp support in the mini package- Don't build-require selinux for the mini package- Drop libgcrypt.m4 The mini package builds fine without it so it doesn't seem necessary anymore.- Import commit d5a5df298ccf490eb1da5cd671922dcda5ec17e1 531a00c84 Restore "restore /var/run and /var/lock bind mount if they aren't symlink""- Import commit fd4e9389d87901c420a5a05dd016a002bc9e85b2 7fb9ea39a Revert "restore /var/run and /var/lock bind mount if they aren't symlink" 23ce1207a meson.build: make docdir configurable (#8068)- Import commit 08eebc34ac22b2175321f3a8814ed0aca3bc88bb 07c6ee3eb compat-rules: get rid of scsi_id when generating compat symlinks for NVMe devices (bsc#1051465)- Drop 0001-compat-rules-get-rid-of-scsi_id-when-generating-comp.patch It's been merged in branch "compats/udev-compat-symlinks" which was merged in branch "SLE15" in its turn.- Import commit b4e4c090b2238e80f4d82b11739bc428d3f0e00f 37da1facb core: disable session keyring per system sevice entirely for now (bnc#1045886) 8a1ae0449 strv: fix buffer size calculation in strv_join_quoted() 2b8971b8a tmpfiles: refuse to chown()/chmod() files which are hardlinked, unless protected_hardlinks sysctl is on (bsc#1077925 CVE-2017-18078) 8c2bcac25 tmpfiles: change ownership of symlinks too- Drop 0001-core-disable-session-keyring-per-system-sevice-entir.patch It's been merged in branch "SUSE/v234".- Import commit b8dab767c4df0fba4766f1e2b9977a2cd329b20e 3d60486f7 core/timer: Prevent timer looping when unit cannot start (bsc#1068588) 54c0add7c logind: store a timestamp when the ACPI power button is pressed (bsc#981830 bsc#888612 bsc#1072933) 460bd0cd6 Revert "handle SYSTEMCTL_OPTIONS environment variable" (fate#323393)- Drop 0001-Revert-handle-SYSTEMCTL_OPTIONS-environment-variable.patch The patch has been merged in SUSE/v234 since its counterpart in YaST has been accepted in Factory and SLE15.- Drop 0001-logind-store-a-timestamp-when-the-ACPI-power-button-.patch The patch has been verified on Beta5 and hence has been merged in "SLE15" branch.- Import commit c2ed2c6dc3aed4b3c22cfcd4b8fd28da01f6471e aa3eba828 delta: don't ignore PREFIX when the given argument is PREFIX/SUFFIX b1ea0173a delta: extend skip logic to work on full directory paths (prefix+suffix) (bsc#1070428) 77c5065f9 delta: check if a prefix needs to be skipped only once db32866d1 Fix parsing of features in detect_vm_xen_dom0 (#7890) (bsc#1048510) 11d40461a sd-bus: use -- when passing arguments to ssh (#6706)- Edit scripts-systemd-fix-machines-btrfs-subvol.sh We shouldn't be creating a /var/lib/machines subvolume if /var is already a seperate partition or subvolume. /var/lib/machines will already be excluded from snapper & similar tooling in this case.- Import commit 290129a57006338211f8c139a52402cb1ccebbf7 1148d99f6 tmpfiles: consider /etc uninitialized also when /etc/machine-id is present but empty (#7849) (bsc#1075179) 3a95f69bf tmpfiles: downgrade warning about duplicate line- Import commit e1f3d0784798d2a31e7492a26ce660fda2b0ddb8 8c7f0c449 service: Don't stop unneeded units needed by restarted service (bsc#1066156) 869be64ce sysctl: use raw file descriptor in sysctl_write (#7753) 0c2400810 sysctl: disable buffer while writing to /proc (bsc#1071558) 9eb1f30b8 Use read_line() and LONG_LINE_MAX to read values configuration files. (bsc#1071558) 4dbea654f def: add new constant LONG_LINE_MAX 48f14cd71 fileio: add new helper call read_line() as bounded getline() replacement- Add 0001-Revert-handle-SYSTEMCTL_OPTIONS-environment-variable.patch Patch has been quarantined. The only user of SYSTEMCTL_OPTIONS was yast2-installation and its usage has been removed in SLE15 (the changes are still pending for Factory).- Import commit d4267fb7c1c6718015309275d303e652155705f8 861e1a222 build-sys: udevadm should have LOG_REALM=LOG_REALM_UDEV 8ed5cf3fb meson: libudev_core and udevadm should have LOG_REALM=LOG_REALM_UDEV (#7666) a9f93f1d0 virt: use XENFEAT_dom0 to detect the hardware domain (#6442, #6662) (#7581) (bsc#1048510) fe56abdf9 seccomp: arm64/x32 do not have _sysctl (bsc#1069239) c9194fe37 seccomp: arm64 does not have mmap2 (bsc#1069239) 31d9b3c32 fs-util: small tweak in chase_symlinks() 9dd0bc7a3 meson: do not include man/meson.build if xsltproc not found 7e29e2b07 analyze: replace --no-man with --man=no in the man page (bsc#1068251)- Add missing /etc/systemd/network directory backported from Factory- Add (back) 0001-logind-store-a-timestamp-when-the-ACPI-power-button-.patch (bsc#1072933) Patch added in the quarantine area. Once tested it could be moved to the SLE15 branch.- Stop importing i18n settings from /etc/sysconfig (fate#319454) Add the 2 following patches in the quarantine area: 0001-Revert-locale-setup-handle-locale-at-boot-time-well.patch 0002-Revert-vconsole-setup-add-SUSE-specific-settings-for.patch- Import commit 00dc7ae09282e074a16b37a7329296371cb9efda 63481b24b firstboot: do not write vconsole.conf when arg_keymap is empty (bsc#1070124)- Add 0001-compat-rules-get-rid-of-scsi_id-when-generating-comp.patch (bsc#1051465) This patch is not yet merged in the 'compats/udev-compat-symlinks' branch: we asked to upstream if it would be possible to introduce a new specifier that wouldn't strip trailing whitespaces , see https://github.com/systemd/systemd/issues/7462 Also this allows to give the patch more testing before merging it in the git repo.- Drop a useless rm(1) from the specfile- Add 80-acpi-container-hotplug.rules (bsc#1040800) A "temporary" rule file that is maintained by the kernel team until a proper solution is found in the kernel. It doesn't belong to udev normally but for convenience purpose we welcome this homeless rule.- Remove requires for pwdutils, we don't need the shadow tools anymore [bsc#1069150]- Drop 0001-systemd-firstboot-add-vconsole-keymap-support.patch It's not needed since it's been merged in the git repo (see commit 86804326f).- Import commit 79ede6be5b01b6031637e3ac95248a9bf392ce7c 22dcb1d04 tmpfiles: when /etc is not fully initialized, some specifiers are expected to be unresolvable (#6860) (bsc#1055664) 216beb768 tmpfiles: Allow create symlink on directories (#6039) baf85eb79 udev: net_setup_link: don't error out when we couldn't apply link config (#7328) 86804326f systemd-firstboot: add vconsole keymap support (#7035) (bsc#1046436) - Remove stderr redirection to /dev/null when calling %tmpfiles_create since it's not needed anymore due to commit 22dcb1d04. Indeed the messages are no more emitted at LOG_WARN but LOG_NOTICE.- Fork Factory and create a dedicated project for SLE15. It will contain all SLE15 dedicated bits: - forward port all SLE dedicated patches - merge compats/persistent-nic-names (bsc#1061883) - update with compats/udev-compat-symlinks - update with SUSE/v234 - disble networkd, resolved, journal-remote - Import commit 0053b83a1d913954f0d2eb22bb2a0df2ef252e19 9b64225e9 (origin/SUSE/v234, SUSE/v234) resolved: fix loop on packets with pseudo dns types (bsc#1065276 CVE-2017-15908) 261a4ef38 (origin/compats/udev-compat-symlinks, compats/udev-compat-symlinks) compat-rules: generate compat by-id symlinks with 'nvme' prefix missing (bsc#1063249) 9707249bc udev: add option to generate old 'buggy' SCSI serials 52cf64d2b journald: turn ForwardToSyslog= on by default (bsc#1065301) e2f3cf5f2 logind: disable RemoveIPC by default 7a2a3b134 (origin/compats/persistent-nic-names, compats/persistent-nic-names) udev: add a persistent rule for ibmvnic devices 74b2d3b88 udev: disable predictable network interface names by default ef9f437a0 udev: Revert the use of -DNET_IFNAME=1 to use persistent name by default e61a078ed udev: move persistent net rule generator to SCRIPTS 9c95cc9ac udev: rework KVM persistent rules generatior (again) 760a6f70d udev: fix persistent netrule generator for KVM 9d173534c udev: better checks in write_net_rules() in persistent net rule generator 5540a0b7c udev: fix duplicated rules with layer3 interfaces in persistent net rule generator d87359c59 udev: re-enable dev_id conditionally in persistent net rule generator 5a0c34683 udev: disable usage of dev_id in persistent net rule generator 73fa44a85 udev: re-add persistent net rule generator a7d25354d Revert "udev: network device renaming - immediately give up if the target name isn't available"- Import commit e44237e76f6e133e62ff6c681d3fd06ebf12f66d a4e02c099 udev-rules: all values can contain escaped double quotes now (#6890) d2b767a76 tmpfiles: remove old ICE and X11 sockets at boot (#6979)- Add 0001-systemd-firstboot-add-vconsole-keymap-support.patch (bsc#1046436) Temporary patch until it's been merged by upstream, see https://github.com/systemd/systemd/pull/7035- Damn forgot to drop 0001-Revert-core-device-Use-JobRunningTimeoutSec-for-devi.patch in the spec file- Import commit 6dea894131d78b20b9e0482f75afa6ee4dec8627 1cdd944b0 unit: when JobTimeoutSec= is turned off, implicitly turn off JobRunningTimeoutSec= too (bsc#1004995) This make 0001-Revert-core-device-Use-JobRunningTimeoutSec-for-devi.patch not needed anymore.- Import commit 93688f8e53b4e482a55a7d4aba2d927ddedebdde c53522be3 compat-rules: allow to specify the generation number through the kernel cmdline- Import commit c1e8af7d1e8b09c2878a5b17f513bfc41ae46dc6 982754275 build-sys: make sure 61-persitent-storage-compat.rules is installed with meson 9ac2e8b9b udev: proc_cmdline_get_key() FTW! (#6925)- Import commit 9e0985dc330b1cf04bc44049962343bdf4ba851a 4fd7cd041 pam_logind: skip leading /dev/ from PAM_TTY field before passing it on dd6312828 logind: make sure we don't process the same method call twice (#6583)- Update scripts-systemd-upgrade-from-pre-210.sh script - drop dependency on awk - fallback to runlevel #3 if something goes wrong Note: I'm not sure how this is supposed to work as /etc/inittab is likely to be missing in my understanding. Indeed this file is part of the aaa_base package which might be upgraded before systemd is installed...- Drop macros.systemd.upstream as it's not used- Import commit 58ea3c819cca1639ef8c922505c573ba5e262b3d 334945091 shutdown: fix incorrect fscanf() result check (#6806) 027202892 shutdown: don't remount,ro network filesystems. (#6588) (bsc#1035386) bc77b53a5 shutdown: don't be fooled when detaching DM devices with BTRFS (boo#1055641) d9d293847 util: make get_block_device() available 421ce7382 tmpfiles: silently ignore any path that passes through autofs (#6506) (bsc#1045472) ca8f90e62 device: make sure to remove all device units sharing the same sysfs path (#6679)- Make use of "%tmpfiles_create" in %post of the logger subpackage- Add scripts-udev-convert-lib-udev-path.sh (bsc#1050152) This script takes care of converting /lib/udev into a symlink pointing to /usr/lib/udev when upgrading a distro using an old version of udev.- Make use of "%make_build" rpm macro- Renumber scripts to start at index 100- Introduce scripts-systemd-upgrade-from-pre-210.sh It collects all existing hacks done in %post to fix old/deprecated settings in systemd older than 210. This includes hacks needed to fix system that are migrating from SysV. There shouldn't be any functional changes.- Move scripts for packaging workaround/fixes in /usr/lib/systemd/scripts It also renames fix-machines-subvol-for-rollbacks.sh into scripts-systemd-fix-machines-btrfs-subvol.sh Note that the "scripts-systemd-" prefix is used for those scripts so we can gather them. Why not using a directory instead ? because osc doesn't allow that.- Add 0001-Revert-core-device-Use-JobRunningTimeoutSec-for-devi.patch (bsc#1048605) It's a temporary but urgent fix for a regression discovered in bug 1048605. The fix is still under discussion with upstream but we need to make progress here and limit the number of affected users. Consequently this fix reintroduces bsc#1004995 (the bug report has been re-opened) but this one is far less critical and a workaround was provided. The final solution will fix both bugs.- Import commit 2bed4bf99cf7f24eafda490f778ed5e109f8d7f1 7a4935268 compat-rules: drop the boggus 'import everything' rule (bsc#1046268)- %regenerate_initrd_post is suppsed to be used in %post (not %pre) section- Import commit 6887cc21f23e33ac37801a01d76176e5c16fd8ea 9dcc6c04e pid1: forward port console specificities handling for s390 arch to v234- Import commit 986e98fd5a75470ba17e21fea12d7d4e966c1ecc 4706ebc62 call chase_symlinks without the /sysroot prefix (#6411) (boo#1051172)- Remove the unneeded hack forcing systemd-crypsetup binary to be linked against the just built libudev I don't remember why it was added but it looks unnecessary: most of all systemd components are linked againt libsystemd-shared.so which includes all the just built symbols. Also I don't see why it was done only for systemd-cryptsetup since all other binaries should have had suffered from the same issue.- Import commit c5705e01800bdadd6a4fa7dc50d47b13eb697211 8ea065d44 compat-rules: don't rely on ID_SERIAL when generating 'by-id' symlinks for NVMe devices (bsc#1048679)- Import commit 06bed720274d9436405a7c27c8238d7d1aefca2b 66fffdf12 build-sys: don't hook var-lib-machined.mount to remote-fs.target when machined is disabled 96c232066 Revert "core: don't load dropin data multiple times for the same unit (#5139)"- Drop support of compression from the mini package Hence remove the relevant build-requires from the mini package.- Upgrade to v234 (commit 78af11131da1b2760778206806c0ebe8616a5284) - package /etc/systemd/system/dbus-org.freedesktop.network1.service - /usr/lib/systemd/resolv.conf is not installed if resolved is disabled- Edit pkgconfig(liblz4) dependency: liblz4 now uses 1.x *again*- Added 0001-core-disable-session-keyring-per-system-sevice-entir.patch (bnc#1045886) Temporary patch to disable the session keyring stuff as it's currently broken and may introduce some security holes.- Import commit 21827ea0875ff197e16e72003b2bfaa1c6e8daad 1ad06735f core: fail when syntactically invalid values for User=/Group= fields are detected (bsc#1047023) d563972e2 timesyncd: don't use compiled-in list if FallbackNTP has been configured explicitly f4e0c16f5 gpt-auto-generator: fix the handling of the value returned by fstab_has_fstype() in add_swap() (#6280) e1345aac5 fix add_esp() in the gpt-auto-generator.c (#6251) c591ece9a automount: don't lstat(2) upon umount request (#6086) (bsc#1040968) 643ab2eea gpt-auto-generator: disable gpt auto logic for swaps if at least one is defined in fstab f07d2022f fstab-util: introduce fstab_has_fstype() helper bf735bb35 fstab-util: don't eat up errors in fstab_is_mount_point() a4b40fbed resolved: simplify alloc size calculation (bsc#1045290 CVE-2017-9445) 8b960bec0 only check signature job error if signature job exists (#6118) (boo#1043758) 1418bfb5b job: Ensure JobRunningTimeoutSec= survives serialization (#6128) (bsc#1004995) 19b6d5f08 udev: turn off -Wformat-nonliteral for one safe case 717ace439 udev: net_id add support for platform bus (ACPI, mostly arm64) devices (#5933) a3bf2e6b5 core/mount: pass "-c" flag to /bin/umount (#6093)- Add minimal support for boot.d/* scripts in systemd-sysv-convert (boo#1046750) While at it, the handling of the symlink priorities is also removed since it doesn't appear to be used at all.- Don't try to restart networkd/resolved if they're disabled (boo#1045521) "systemctl try-restart/preset" wants the unit files exist.- Stop shipping /usr/lib/sysusers.d/basic.conf (bsc#1006978) Ok looks like the previous change was the right thing to do and we continue to follow this path by relying on the new user/group scheme Therefore the basic system user/group are now managed and created by system-sysusers and udev also relies on this for the groups it uses in its rule files. Ideally we should have listed all of the groups in the deps (with "Requires: group(disk)" but the list of the groups is rather long and the risk for those groups to be re-organized is probably low, so currently we simply use "Requires: system-group-hardware" as a shortcut.- Make sure "lock" group is created On SUSE distros, /run/lock must be owned by "lock" group (see boo#733523). This group was previously created by another package but since a recent changes it doesn't seem to be true anymore or at least this package isn't pulled in anymore when building the rescue system. For now make systemd creates the group by adding "Requires: group(lock)". I'm currently not sure why we don't use sysusers.d stuff for that purpose and if the "lock" group on /run/lock is still mandatory. This should be revisited later.- Make sure dracut (if installed) will embed the new compat rule The new compat rule must be embedded in the initramfs so make sure that the installed dracut supports it.- Upgrade to v233 (commit 330b55d5e28d17f361062dba66426e46fb7d7857) - package new systemd-umount binary - package new environment generator stuff - drop /dev/root symlink support - /etc/pam.d/systemd-user is not patched anymore but we ship a dedicated file for SUSE now. - manage compat symlink generation in a dedicated branch (bsc#1040153)- Fix systemd-sysv-convert when a package starts shipping service units (bsc#982303) The database might be missing when upgrading a package which was shipping no sysv init scripts nor unit files (at the time --save was called) but the new version start shipping unit files.- Fix indentation in systemd-sysv-convert While at it, strip trailing whitespaces. No functional changes.- Disable group shadow support (bsc#1029516) The new configure option will be imported during the next tarball update.- Ship /var/log/README Unfortunately it's not possible to also ship /etc/init.d/README because of rpm "sanity" checks that prevent executable in /etc/init.d- Drop systemd-{journalctl,loginctl} legacy symlinks.- Drop %preun section Currently the only use of this section is to remove the symlinks enabling systemd services on package removal. Those symlinks were initially installed by the systemd package installation but could have been overriden by the sysadmin later. If so the symlinks shouldn't be uninstalled. Also in a near futur disabling services will install a symlink to /dev/null.- Import commit 9e33c2ae69fbb705e8ad143536e419a231e93020 04ef0eab8 importd: support SUSE style checksums supplementary (#5800) fb601ad9a importd: support SUSE style checksums (#5206) (fate#322054) b76b27c76 hwdb: fix warning "atkbd serio0: Unknown key pressed" (#5772) (boo#1010220) cb0d991f6 loginctl: fix typo causing ignoring multiple session IDs (#5732)- Make use of %systemd_postun()- Restart a couple of systemd services on package update Those services (most notably journald) should support restarting these days. However logind still doesn't but that should be fixed pretty soon, well I hope :)- Don't buildrequire pam-config, it's not used at this step. Also drop the use of it in %postun as it can't realistically happen...- Don't call /sbin/ldconfig in %post of the main package systemd main package doesn't ship any shared libs so there's no point in calling ldconfig in %post/%postun- Silent %tmpfiles_create in %post (bsc#1034938) Due to bsc#1024740, we stopped generating /etc/machine-id during systemd package installation making the specifier '%m' unavailable in the tmpfiles.d configuration files at this time. Make it simple for now and silent %tmpfiles_create, after all that's how the macro was implemented originally.- Import commit f0325620d23a247682c629d28883a364e4a7a8c4 327814841 core: when a unit's SourcePath points to API VFS pretend we are never out-of-date (#5487) f4b9fb58e units: move Before deps for quota services to remote-fs.target (#5627) (bsc#1028263) 44b9d27f8 udev: net_id - support predictable ifnames on vio buses (#5675) (bnc#1029183) 64f4761c9 units: apply plymouth warning fix to in rescue mode as well (#5615) 77607b887 units: do not throw a warning in emergency mode if plymouth is not installed (#5528) (bsc#1025398) 336d6016c core: downgrade "Time has been changed" to debug (#4906) (bsc#1028610)- Consider chroot updates in fix-machines-subvol-for-rollbacks.sh (bsc#1030290)- Initialize /etc/machine-id during the first boot (bsc#1024740) Previously that was done at package installation but it didn't fit well for appliance builds.- Import commit 68fc0a749a83d16d4cde8471d5030bc6254ffd96 76d4d05fb udev: fix variable assignment 473df8cc4 udev-rules: perform whitespace replacement for symlink subst values (bsc#1025886) d6c3ff647 udev-event: add replace_whitespace param to udev_event_apply_format 30ad15f7c libudev-util: change util_replace_whitespace to return number of chars in dest- Import commit 103259b3226251d06f79ca627f7b0ba0bd49f4bc 0ee7890dd automount: if an automount unit is masked, don't react to activation anymore (#5445) 99865a181 core: make sure to destroy all name watching bus slots when we are kicked off the bus (#5294) (bsc#1006687) f34234c54 build-sys: add check for gperf lookup function signature (#5055) 44e39538f sd-event: "when exiting no signal event are pending" is a wrong assertion (#5271) (boo#995936 bsc#1022014) 471b26807 sd-event: when an event source fails, don't assume the type of it is still set- Don't ship systemd-resolved for now (bsc#1024897) If resolved is enabled , systemd-tmpfiles creates a wrong symlink in /etc/resolv.conf which confuses the network manager actually used.- More indentation cleanup (no functional changes)- Remove obsolete insserv requirements for udev again [bsc#999841]- Import commit cd97d5d5fef79ab9d957bf6504d085c0faca6bfc e587b6ce0 disable RestrictAddressFamilies on all architectures but x86_64 one (bsc#1023460) c8ae05632 journald: don't flush to /var/log/journal before we get asked to (bsc#1004094) 7261eaf3e sd-event: fix sd_event_source_get_priority() (#4712)- Move fix for permission set on /var/lib/systemd/linger/* (no functional changes) Move that part after the fix on timer timestamp files otherwise the comment doesn't make sense.- Import commit 028fd9b60580976dffb09b3576a2b652ee35137c cc2ca55ff build-sys: do not install ctrl-alt-del.target symlink twice ececae77a device: Avoid calling unit_free(NULL) in device setup logic (#4748)- Ship systemd-resolved but it's disabled by default (bsc#1018387) The NSS plugin will also be disabled, users need to enable it manually.- Don't ship ldconfig.service anymore This service was introduced to support stateless systems that support offline /usr updates properly. AFAIK we don't support any such system for now, so disable it. If it's wrong it's easy enough to restore it back. Related to bsc#1019470.- Be more consistent with indentation (*no* functional changes) Indentation should use 8 spaces now (no tabs).- Import commit 2559bc0c076b58f0a649056e79ca90fe5f1d556c 9c4a759ab systemctl: 'show' don't exit with a failure status if the requested property does not exist [SUSE] (bsc#1021062) f9194193b systemctl: remove duplicate entries showed by list-dependencies (#5049) (bsc#1012266) 2a6653335 rule: don't automatically online standby memory on s390x (bsc#997682)- Fix permission set on /var/lib/systemd/linger/* Those files are created by logind which run with umask(0022), so they are not world writable and shouldn't be affected by bsc#1020601. But it's cleaner to not let files forever with their setuid bit set for no good reason.- Fix permissions set on permanent timer timestamp files (bsc#1020601) (CVE-2016-10156) This change makes sure to fix the permissions of the timestamp files which could have been created by an affected version of systemd. Local unprivileged users could have run arbitrary code as root if systemd previously created world writable suid root files such as permanent timer stamp files.- Import commit 3edb876e3b80437a95502aa5d31d454606ea94bd 27b544224 core: make sure to not call device_is_bound_by_mounts() when dev is null (#5033) (bsc#1018399)- Use the %{resolved} build conditional for the nss-resolve subpackage- /usr/bin/systemd-resolve was missing from the filelist- Silent warnings emitted when udev socket units are restarted during package upgrade (bsc#1018214)- Upgrade to v232, commit de62e96da6a62ac61a7dea45cc558f5fa4342032 - a4dff165d nspawn: resolv.conf might not be created initially (#4799) - b543fe907 nspawn: fix condition for mounting resolv.conf (#4622) - 1aed89e55 core: make mount units from /proc/self/mountinfo possibly bind to a device (#4515) (boo#909418 bsc#912715 bsc#945340) - bfb54ecdc coredumpctl: let gdb handle the SIGINT signal (#4901) (bsc#1012591)- Really include legacy kbd maps in kbd-model-map (bsc#1015515) Instead of fix-machines-subvol-for-rollbacks.sh...- Enable lz4 (which becomes the default) It's much faster than xz and thus should be more appropriate to compress journals and coredumps. The LZ4 logic is now officially supported and no longer considered experimental. The new frame api was released in v125.- Good by compatlibs support There's no longer need for enabling/disabling the support for the compatlibs as it's been dropped from the source code.- Drop /usr/lib/systemd/libsystemd-shared-%{version}.so from the 32bit package This shared library is not for public use, and is neither API nor ABI stable, but is likely to change with every new released update. Only systemd binaries are supposed to link against it. This also prevents from the 32bit package to conflit with the 64bit one if this lib was installed by both packages.- Upgrade to v232, commit c5c3445825981e2a5c3ed71214127d5b1b9de802: - Dropped backported commits which has been merged - Forward-port Suse specific patches - Added --disable-lto option to ./configure - Added systemd-mount - Removed in %file /usr/lib/systemd/user/*.socket: since 798c486fbcdce3346cd86 units/systemd-bus-proxyd.socket has been removed. - Removed in %file %{_sysconfdir}/systemd/bootchart.conf since commit 232c84b2d22f2d96982b3c bootchart is not part of systemd anymore. - Backward compat libs have been disabled since it's been dropped from the source code. - Added /usr/bin/systemd-socket-activate in %file - Added --without-kill-user-processes ./configure option - Bump libseccomp build require (>= 2.3.1) as described in README - Specifiy version of libmount as required in the README- libudev-devel 32bit is needed for building 32bit wine now.- specfile: conflict systemd-bash-completion and systemd-mini-bash-completion Otherwise the build system detects that systemd-bash-completion and its mini variant are conflicting at files level even though those packages can't be installed on the same system.- specfile: clean up nss-* plugins descriptions and drop nss-myhostname-config script for now. Currently /etc/nsswitch.conf is supposed to be edited by the sysadmin to enable the modules. However for some reasons only nss-myhostname is removed from the conf file when the corresponding package is uninstalled. This is inconsistent so let's remove it. Actually I'm wondering if we shouldn't make those NSS plugins part of the main package and get rid of all those sub-packages...- specfile: remove old comments and unneeded sed command- specfile: no need to create systemd-update-utmp-runlevel.service symlinks anymore The symlinks in /usr/lib/systemd/system/.target.wants/systemd-update-utmp-runlevel.service are created in Makefile.am since commit d5d8429a12c4b1. 'reboot' and 'poweroff' targets initially had the symlinks but there's not point since the latter conflicts shutdown.target whereas the 2 targets pull it in. See: https://github.com/systemd/systemd/pull/4429- specfile: remove the following warnings: [ 256s] warning: File listed twice: /usr/lib/systemd/system/dbus.target.wants [ 256s] warning: File listed twice: /usr/lib/systemd/system/default.target.wants- Own a couple of directories even if they don't belong to systemd otherwise the build system will complain. Some directories (owned by others packages) are simply used by systemd to ship some scripts or config files to customize others * optional* components. Since thos components are not build required by systemd those directories are not owned by any packages and the BS complains...- Import commit 15ea716 journal-remote: change owner of /var/log/journal/remote and create /var/lib/systemd/journal-upload (bsc#1006372)- %sysusers_create and %tmpfiles_create must be called in %post Calling %pre is broken since the respective conf files are not yet installed.- %{_libexecdir}/{tmpfiles.d,sysusers.d}/systemd-remote.conf are part of systemd-journal-remote package (only).- systemd-journal-{gatewayd,remote,upload} units are only part of "systemd-journal-remote" package. So exclude them from the main package.- Import commit a1c145e6ad6588555dca64402f9103fb1e02b1a0 7f34037 man: explain that *KeyIgnoreInhibited only apply to a subset of locks df5798b Revert "logind: really handle *KeyIgnoreInhibited options in logind.conf" (bsc#1001790 bsc#1005404) f79fee7 Revert "kbd-model-map: add more mappings offered by Yast" 3760c10 manager: tighten incoming notification message checks d6efd71 core: only warn on short reads on signal fd 6eebd91 manager: be stricter with incomining notifications, warn properly about too large ones fdf2dc3 manager: don't ever busy loop when we get a notification message we can't process- Rename kbd-model-map-extra into kbd-model-map.legacy- Remove tcpd-devel build requirement. tcpwrap support has been removed since v212, see commit 7f8aa67131cfc03ddcbd31c0420754864fc122f0- remove all dummy "aliases" to /etc/init.d (as it was already done by factory more than 1 year ago). Even if a sysvinit script is still requiring one of those dummy symlinks this should not be an issue since this is requirement is translated into a weak dependency.- specfile: - do not own /usr/share/zsh directory - do not own /etc/dbus-1 and /etc/dbus-1/system.d dirs - do not own /usr/share/dbus-1 dir- specfile: %{_prefix}/lib/systemd/system-preset was mentioned twice in %files section.- Specfile cleanup: - use curly braces with rpm macros- Specfile cleanup: - %ghost files doesn't need (anymore) to be created in %builroot - do not own /etc/X11/xorg.conf.d and /etc/X11/xinit- Specfile cleanup: no need to protect the manpages with %bootstrap condition in nss-myhostname package since the package itself is already protected.- fix nss-resolve sub package: - add a %files section - add a package description - libnss_resolve.so.2 is now part of this subpackage - add %post and %postun sections- Specfile cleanup: - reorganize some files in %files by types - some config files were missing the "noreplace" attribute- Use %config(noreplace) for %{_sysconfdir}/pam.d/systemd-user- Rework systemd-gatewayd package: - some gateway's files were still in the main package - it now includes all progs dealing with remote journals - it can be turned off (SP2 does that currently) - it's been renamed systemd-journal-remote to reflect that- Specfile cleanup: - only specify once %{_prefix}/lib/systemd/system-shutdown in %file - no need to list the content of %{_prefix}/lib/systemd/user-generators in %file - machined is not built when %bootstrap = 1- Specfile cleanup: - There's no point in listing all generators in %file explicitly. The default is to include all of them and if for some reason one must be excluded then it should be done explicitly.- Specfile cleanup: - remove explicit call to make for building man pages. This is not needed and was maybe useful when generated doc was pre-built and shipped in the tarball.- Specfile cleanup: - break overly long and unreadable line using mkdir - gather directory creations- Stop providing udevd.8 systemd-udevd has replaced udevd for some time already and usage of udevd should be avoided. Therefore don't encourage this and stop documenting it.- Import from factory: - Thu Feb 4 11:05:37 UTC 2016 - lnussel@suse.de - curl also causes building of journal-upload. That one has rather unusal certificate usage, set it's ca root to /etc/pki/systemd instead of the built-in default /etc/ssl as journal-remote and journal-upload think they can put stuff in /etc/ssl/certs then but that directory is managed by p11-kit and doesn't serve the purpose those programs think.- Package rootsymlink-generator helper. It was forgotten when switching to the git repo but re-added back. That said this thing should be removed as it's broken as soon as there's no direct link between the root fs and its backend device node (i.e. BTRFS).- Add kbd-model-map-extra file which contains the additional legacy keymaps needed by yast. This was previously directly patched in the systemd source code.- Imported e251b8d7fb5c801fdfa3a023257ba0e4d514f3b0 - Re-add back /dev/root symlink generation (although this must be deprecated and finally removed).- Migrating to the Suse Systemd git repo: Third step: - Re-enable networkd (disabled by default in SLE12)- Migrating to the Suse Systemd git repo: Second step: - Import the specfile - Import the tarball generated from the git repo - Import lastest changes for the different scripts- Migrating to the Suse Systemd git repo: First step: drop all patches and drop the tar ball. The dropped patches are: fix-support-for-boot-prefixed-initscript-bnc-746506.patch set-and-use-default-logconsole.patch ensure-ask-password-wall-starts-after-getty-tty1.patch 0001-rules-block-add-support-for-pmem-devices-3683.patch Fix-run-lock-directories-permissions-to-follow-openSUSE-po.patch 1007-physical-hotplug-cpu-and-memory.patch 1066-udev-add-compatibility-links-for-truncated-by-id-links.patch watch_resolv.conf_for_become_changed.patch 0019-make-completion-smart-to-be-able-to-redirect.patch systemd-add-user-keep.patch 0001-core-re-sync-bus-name-list-after-deserializing-durin.patch systemd-228-nspawn-make-journal-linking-non-fatal-in-try-and-auto.diff avoid-random-hangs-on-timeouts-due-lost-cwd.patch 1037-udev-exclude-cd-dvd-from-block-device.patch 0001-add-network-device-after-NFS-mount-units.patch journald-advice-about-use-of-memory.patch 1011-64-btrfs.rules-skip-btrfs-check-if-devices-are-not-r.patch 1006-udev-always-rename-network.patch handle-numlock-value-in-etc-sysconfig-keyboard.patch use-rndaddentropy-ioctl-to-load-random-seed.patch 0001-pid1-don-t-return-any-error-in-manager_dispatch_noti.patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch 0001-pam_systemd_do_override_XDG_RUNTIME_DIR_of_the_original_user.patch 0001-bnc888612-logind-polkit-acpi.patch avoid-divide-by-zero-sigtrap.patch 1035-99-systemd.rules-Ignore-devices-with-SYSTEMD_READY-0.patch suse-sysv-bootd-support.diff ensure-shortname-is-set-as-hostname-bnc-820213.patch parse-crypttab-for-noauto-option.patch tty-ask-password-agent-on-console.patch 0001-pid1-process-zero-length-notification-messages-again.patch handle-root_uses_lang-value-in-etc-sysconfig-language.patch 0001-core-exclude-.slice-units-from-systemctl-isolate.patch vhangup-on-all-consoles.patch 0001-systemctl-pid1-do-not-warn-about-missing-install-inf.patch apply-ACL-for-nvidia-device-nodes.patch make-emergency.service-conflict-with-syslog.socket.patch 0001-journal-warn-when-we-fail-to-append-a-tag-to-a-journ.patch 1096-new-udev-root-symlink-generator.patch 1099-Add-default-rules-for-valve-steam-controller-to-work.patch 0001-journal-set-STATE_ARCHIVED-as-part-of-offlining-2740.patch systemd-install-compat_pkgconfig-always.patch 1012-Skip-persistent-device-link-creation-on-multipath-de.patch 0001-avoid-abort-due-timeout-at-user-service.patch insserv-generator.patch apply-ACL-for-nvidia-uvm-device-node.patch restore-var-run-and-var-lock-bind-mount-if-they-aren-t-sym.patch systemd-pam_config.patch systemd-dbus-system-bus-address.patch let-linker-find-libudev-for-libdevmapper.patch 1098-systemd-networkd-alias-network-service.patch 0001-let-systemctl-completion-ignore-at-names.patch boot-local-start.patch 1095-set-ssd-disk-to-use-deadline-scheduler.patch tomcat6-var-lock-subsys-legacy.patch let-vconsole-setup-get-properties-only-once-to-copy-them.patch plymouth-quit-and-wait-for-emergency-service.patch respect-nfs-bg-option.patch 0001-If-the-notification-message-length-is-0-ignore-the-m.patch 1062-rules-set-default-permissions-for-GenWQE-devices.patch rescue-emergency-target-conflicts.patch Correct_assert_on_unexpected_error_code.patch 1097-udevd-increase-maximum-number-of-children.patch 0001-core-fix-bus-name-synchronization-after-daemon-reloa.patch 1005-create-default-links-for-primary-cd_dvd-drive.patch allow-multiple-sulogin-to-be-started.patch systemd-230-cgroup2-use-new-fstype-for-unified-hierarchy.patch 0010-do-not-install-sulogin-unit-with-poweroff.patch 1003-udev-netlink-null-rules.patch 1002-rules-create-by-id-scsi-links-for-ATA-devices.patch 0001-nss-mymachines-do-not-allow-overlong-machine-names.patch shut-up-rpmlint-on-var-log-journal.patch systemd-tmp-safe-defaults.patch portmap-wants-rpcbind-socket.patch hostname-NULL.patch 0001-pid1-more-informative-error-message-for-ignored-noti.patch 0001-journal-fix-HMAC-calculation-when-appending-a-data-o.patch handle-disable_caplock-and-compose_table-and-kbd_rate.patch kbd-model-map.patch systemctl-set-default-target.patch 0014-journald-with-journaling-FS.patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch- Import a better fix from upstream for bsc#1001765 - Added: 0001-pid1-more-informative-error-message-for-ignored-noti.patch 0001-pid1-process-zero-length-notification-messages-again.patch - Updated (no code changes, only patch metadata) 0001-If-the-notification-message-length-is-0-ignore-the-m.patch 0001-pid1-don-t-return-any-error-in-manager_dispatch_noti.patch- Re add back "udev: don't require nsserv and fillup" Did this in the wrong project... it was a complicated day today ;)- Added 2 patches to fix bsc#1001765 0001-If-the-notification-message-length-is-0-ignore-the-m.patch 0001-pid1-don-t-return-any-error-in-manager_dispatch_noti.patch- Revert "udev: don't require nsserv and fillup" It's been judged too late for being part of SLE12 final release. Nevertheless it's part of Factory and will be reintroduced after the final release is out (ie through an update).- systemd-sysv-convert: make sure that /var/lib/systemd/sysv-convert/database is always initialized (bsc#982211) If "--save" command was used and the sysv init script wasn't enabled at all the database file wasn't created at all. This makes the subsequent call to "--apply" fail even though this should not considered as an error.- Added patches to fix journal with FSS protection enabled (bsc#1000435) 0001-journal-fix-HMAC-calculation-when-appending-a-data-o.patch 0001-journal-set-STATE_ARCHIVED-as-part-of-offlining-2740.patch 0001-journal-warn-when-we-fail-to-append-a-tag-to-a-journ.patch- udev: don't require nsserv and fillup (bsc#999841) udev has no LSB init scripts nor fillup templates anymore.- Build require python and python-lxml in order to generate systemd.directives man page (bsc#986952)- Add rules: block: add support for pmem devices (#3683) (bsc#988119) 0001-rules-block-add-support-for-pmem-devices-3683.patch- Fix is-enabled check in systemd-sysv-install (bsc#997268)- Only BuildRequire gnu-efi when building the 'real' systemd package.- Add a script to fix /var/lib/machines to make it suitable for rollbacks (bsc#992573)- reverted the systemctl split-off on request of Franck Bui.- Add sysusers to the new split "systemctl" subpackage- Split systemctl and tmpfiles into a separate package- Fix 1099-Add-default-rules-for-valve-steam-controller-to-work.patch to enable missing functionality of Steam Controller- Backport unified_cgroup_hierarchy fix for Linux >= 4.4. boo#989276 + systemd-230-cgroup2-use-new-fstype-for-unified-hierarchy.patch- drop 1060-udev-use-device-mapper-target-name-for-btrfs-device-ready.patch it breaks btrfs on multiple device-mapper devices (boo#984516). The problem it tried to fix is already fixed in rule shipped with btrfsprogs (see boo#912170).- fix warning about missing install info during preset (boo#970293) 0001-systemctl-pid1-do-not-warn-about-missing-install-inf.patch- Avoid bootstrap cycle with sg3_utils- Fix patch patch handle-numlock-value-in-etc-sysconfig-keyboard.patch that is do not close a file descriptor twice (boo#973907)- Add two patches which address logind/networkd disappearing from dbus (and busctl) even while the units and processes continue running. 0001-core-fix-bus-name-synchronization-after-daemon-reloa.patch 0001-core-re-sync-bus-name-list-after-deserializing-durin.patch- drop all compiler/linker option customizations: - -pipe option is used by default since day 0 - get rid of cflags() function which is not needed - --hash-size has no impact specially in runtime IOW, use the default options for the compiler and the linker, there's no point in making systemd different from other package in this regards.- use %make_build instead of 'make %{?_smp_mflags}'- be more strict on own lib version requirements- systemd should require udev with the exact same version- Modify patch handle-numlock-value-in-etc-sysconfig-keyboard.patch to allow that open, seek, and read of /dev/mem may fail e.g. on XEN based virtual guests (bsc#961120)- Add upstream patch 0001-core-exclude-.slice-units-from-systemctl-isolate.patch this fixes forced logouts on isolate target aka changing runlevel (boo#966535)- require curl and bzip2 to build importd - curl also causes building of journal-upload. That one has rather unusal certificate usage, set it's ca root to /etc/pki/systemd instead of the built-in default /etc/ssl as journal-remote and journal-upload think they kan put stuff in /etc/ssl/certs then but that directory is managed by p11-kit and doesn't serve the purpose those programs think. - /var/lib/systemd/random-seed is a file - own /var/lib/machines - add systemd-228-nspawn-make-journal-linking-non-fatal-in-try-and-auto.diff- systemd-sysv-install: Fix chkconfig argument for disable op- Create groups adm,input,tape in fixed order (boo#944660)- Make sure we don't use tmpfs on /tmp by default (bsc#940522)- Avoid enabling readahead services; they have been removed. - In %install, only process kbd-model-map.xkb-generated if it exists. Resolves a build failure in 13.2/42.1.- spec: update minimum kernel version to 3.11 - Update minimum util-linux version to 2.27.1- Add patch to enable working steam controller: * 1099-Add-default-rules-for-valve-steam-controller-to-work.patch- fix CVE-2015-7510: Stack overflow in nss-mymachines (boo#956712) Add 0001-nss-mymachines-do-not-allow-overlong-machine-names.patch- Update to new upstream release 228 * The various memory-related resource limit settings (such as LimitAS=) now understand the usual K, M, G, ... suffixes to the base of 1024 (IEC). Similar, the time-related settings understand the usual min, h, day, ... suffixes now. * CPUAffinity= now takes CPU index ranges in addition to just individual indexes. * A number of properties previously only settable in unit files are now also available as properties to set when creating transient units programmatically via the bus. - Remove 0001-Make-sure-the-mount-units-pulled-by-RequiresMountsFo.patch (merged upstream)- Update to 227. - Rebase systemd-pam_config.patch, handle-root_uses_lang-value-in-etc-sysconfig-language.patch, 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch, 0001-On_s390_con3270_disable_ANSI_colour_esc.patch, 0014-journald-with-journaling-FS.patch, 0019-make-completion-smart-to-be-able-to-redirect.patch, avoid-divide-by-zero-sigtrap.patch, systemd-add-user-keep.patch, set-and-use-default-logconsole.patch, tty-ask-password-agent-on-console.patch, 0001-bnc888612-logind-polkit-acpi.patch, watch_resolv.conf_for_become_changed.patch, 1097-udevd-increase-maximum-number-of-children.patch. - Remove 0002-units-enable-waiting-for-unit-termination-in-certain.patch, 1001-re-enable-by_path-links-for-ata-devices.patch, rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch: fixed upstream.- Modify patch handle-root_uses_lang-value-in-etc-sysconfig-language.patch to handle locale at boot time well (boo#927250) - Be able to use build service environments several times- 1096-new-udev-root-symlink-generator.patch: fix substitution in ExecStart value- enable seccomp for aarch64 (fate#318444)- Fix again UEFI for mini package- Drop one more undesirable Obsoletes/Provides. This should have been a Conflicts. (There was already a Conflicts, and since Conflicts go both ways, we won't need a second one.)- No UEFI for systemd-mini- Add 2 upstream patches to fix boo#949574 and bsc#932284 0001-Make-sure-the-mount-units-pulled-by-RequiresMountsFo.patch 0002-units-enable-waiting-for-unit-termination-in-certain.patch- Disable systemd-boot on aarch64 since it fails to build. Error while compiling src/boot/efi/util.o is: usr/include/efi/aarch64/efibind.h:2:20: fatal error: stdint.h: No such file or directory- Fix UEFI detection logic: basically we let configure.ac figure out if UEFI is supported by the current build environment. No need to clutter the spec file with a new conditionnal %has_efi. - Provide systemd-bootx64.efi (aka gummiboot)- Modify patch tty-ask-password-agent-on-console.patch to reflect the changes done for pull request 1432- Undo Obsoletes/Provides (from Aug 11), creates too big a cycle. - Provide systemd-sysv-install program/link [bnc#948353]- Fix patch tty-ask-password-agent-on-console.patch not to crash away but enable it to ask on all devices of /dev/console- Avoid "file not found /etc/udev/rules.d/70-persistent-net.rules" waring occurring in %post- Add patch let-vconsole-setup-get-properties-only-once-to-copy-them.patch to avoid broken virtual console mapping due stressed ioctl API for the virtual consoles (boo#904214)- Fix last change that is use the new name for udev packages in %pretrans.- restore usage of LUA in %pretrans.- Try to generate the systemd users and groups always in same order to avoid republish other packages (boo#944660)- cleanup specfile by removing commands that were dealing with systemd pre-generated files: we're now using systemd tarball generated directly from the git repo which doesn't contain any of these files. - there's no point in using LUA in %pretrans- Drop 0009-make-xsltproc-use-correct-ROFF-links.patch This patch was initialy added to workaround bsc#842844. But it appears that man(1) was fixed (included since 13.2 at least) to handle manual pages that consist only of a .so directive such as '.so '.- Change use-rndaddentropy-ioctl-to-load-random-seed.patch to make it work on big endian- Use Obsolete/Provides strategy from windows:mingw:mingw64/mingw64-cross-gcc to do the bootstrap cycle and kick out -mini afterwards.- Update to new upstream release 224 * systemd-networkd gained a number of new configuration options for DHCP, tunnels and bridges * systemd-efi-boot-generator functionality was merged into systemd-gpt-auto-generator.- /usr/share/systemd/kbd-model-map: added entries for xkeyboard-config converted keymaps; mappings, which already exist in original systemd mapping table are being ignored though, i.e. not overwritten; needs kbd in buildrequires (FATE#318426)- hostname-NULL.patch: Work around a crash on XEN hosts in OBS. /etc/hostname is not present and systemd then does strchr(hostname,soemthing) with hostname NULL.- Add Correct_assert_on_unexpected_error_code.patch to work around a problem of an assert on ENODEV for closing fd on an input event device (boo#939571)- Remove udev-generate-rules.sh, apparently not used by anything in the systemd nor udev-persistent-ifnames package.- Systemd v222, bugfix release. - Drop upstream patches 0006-pam_systemd-Properly-check-kdbus-availability.patch 0023-core-fix-reversed-dependency-check-in-unit_check_unn.patch 0031-install-fix-bad-memory-access.patch 1032-ata_id-unbotch-format-specifier.patch - Drop SUSE patch 1013-no-runtime-PM-for-IBM-consoles.patch udev does no longer enable USB HID power management at all. - The udev accelerometer helper was removed, obsoleted by iio-sensor-proxy package. - networkd gained a new configuration option IPv6PrivacyExtensions. - udev does not longer support the WAIT_FOR_SYSFS= key in udev rules. There are no known issues with current sysfs, and udev does not need or should be used to work around such bugs.- Avoid restarting logind [bnc#934901] - Do not suppress errors in any case, even if they are ignored- Fix devel package requires (both mini and real required real libsystemd0)- Rework patch tty-ask-password-agent-on-console.patch to fit the requisition of https://bugs.freedesktop.org/show_bug.cgi?id=82004- Rework "-mini" package logic to not conflict with itself and then add libsystemd0 to mini.- remove SysVStartPriority= from after-local.service, unsupported since v218. Note that this option was only parsed and that's it. the logic to give "start priority" was never implemented.- change the default fallback ntp servers to the opensuse pool.ntp.org vendor zone. - We still need to run systemd-sysctl.service after local-fs.target otherwise it works only when /boot is in the root filesystem but not when it is a separate partition.- Obsolete pm-utils and suspend (boo#925873). - Remove pm-utils support (remove Forward-suspend-hibernate-calls-to-pm-utils.patch).- remove patch sysctl-handle-boot-sysctl.conf-kernel_release.patch from the filelist.- libpcre, glib2 and libusb are not used by systemd, remove from buildrequires.- 1032-ata_id-unbotch-format-specifier.patch: fix udev ata_id output. - 0023-core-fix-reversed-dependency-check-in-unit_check_unn.patch fix StopWhenUnneeded=true in combination with a Requisite= dependency. - 0031-install-fix-bad-memory-access.patch: Fix Bad memory access - 0006-pam_systemd-Properly-check-kdbus-availability.patch: if kdbus is enabled (i.e boot with kdbus=1) DBUS_SESSION_BUS_ADDRESS must not be exported. - spec: add a min_kernel_version macro to ensure the package conflicts with kernel versions in which systemd cannot run.- sysctl-handle-boot-sysctl.conf-kernel_release.patch dropped, replaced by a tmpfiles.d snippet "current-kernel-sysctl.conf" (feature implemented in v220 just for our usecase)- fix build when resolved is enabled - remove fsck -l test in spec file, systemd requires util-linux 2.26 or later where this feature is already available.- Fix bootstrap build by guarding filelists (man pages don't get built in bootstrap mode) - Drop commented sections from baselibs.conf, allows format_spec_file to have a successful run- Install 50-coredump.conf as coredumpctl is now installed by default and does not use journal anymore as default storage- Update to new upstream release 221 * From 220: * libgudev was moved into a package of its own * Runlevels 2, 3 and 4 are no longer distinct, they all map to multi-user.target. * The EFI System Partition mounted to /boot will be unmounted 2 minutes after boot. * systemd does not support direct live-upgrades (via `systemctl daemon-reexec`) from versions older than v44 anymore. * systemd-nspawn may now be called as part of a shell pipeline. * systemd-shutdownd has been removed. This service was previously responsible for implementing scheduled shutdowns as exposed in /usr/bin/shutdown's time parameter. This functionality has now been moved into systemd-logind and is accessible via a bus interface. * udev will no longer call blkid and create symlinks for all block devices, but merely those from a whitelist (cf. 60-persistent-storage.rules). * /usr/lib/os-release gained a new optional field VARIANT= * Details at http://lists.freedesktop.org/archives/systemd-devel/2015-May/032147.html * From 221: * New sd-bus and sd-event APIs in libsystemd * If there is both a systemd unit and a SysV init script for the same service name, and `systemctl enable` or other operation is run, both will now be enabled (or execute the related operation on both), not just the unit. - Split libsystemd0 to support systemd-less nspawn containers - Redo manpage file lists without %exclude, tends to hide unpackaged files. - hwdb belongs to udev - Resolve memory leak and add missing _cleanup_free_ to 0001-On_s390_con3270_disable_ANSI_colour_esc.patch - Remove systemd-powerd-initctl-support.patch (no longer builds because shutdownd is gone) - Remove quilt-patches/0001-core-rework-device-state-logic.patch, 0001-Let-some-boolean-survive-a-daemon-reload.patch (merged upstream), 0001-Let-some-boolean-survive-a-daemon-reload.patch (obsolete)- Remove libudev0 from baselibs.conf- Drop 1055-let-9719859c07aa13539ed2cd4b31972cd30f678543-apply.patch as now upstream code - Add 0001-Let-some-boolean-survive-a-daemon-reload.patch to fix bsc#933365 and boo#934077- Add 1098-systemd-networkd-alias-network-service.patch to alias network.service the same way NetworkManager and wicked does. This is needed by yast2 and other parts of the system. boo#933092- Modify patch 1021-udev-re-add-persistent-net-rules.patch to use the new return values of proc_cmdline() in enable_name_policy() this should fix boo#931165- Drop 1021-udev-re-add-persistent-net-rules.patch, 1036-rules-disable-usage-of-dev_id-in-persistent-rules.patch, 1040-re-enable-dev_id-conditionally-in-persistent-rules.patch, 1046-fix-duplicated-rules-with-layer3-interfaces.patch, 1050-only-rename-SRIOV-VF-devices-when-name-starts-with-eth.patch, 1051-check-if-NAME-has-a-value.patch, 1053-better-checks-in-write_net_rules.patch, 1088-drop-renaming-of-virtual-interfaces-in-guest.patch. 1021 originally broke parsing of net.ifnames=0 [bnc#931165], and given that neither the kernel command line needs to be touched nor the source be patched to reach the unpredictable naming setup for SLE, all these parts are moved to a separate package.- Add upstream patch 0001-core-don-t-change-removed-devices-to-state-tentative.patch to fix the fix of the last backport (bsc#921898)- Reenable networkd which was silently disabled on Feb 18- Add 0001-core-rework-device-state-logic.patch to fix spurious automated umount after mount.- mark more subpackages as !bootstrap for systemd-mini usage.- spec : remove --with-firmware-path, firmware loader was removed in v217 - spec: remove --disable-multi-seat-x, gone.(fixed in xorg) - spec: Do not enable systemd-readahead-collect.service and systemd-readahead-replay.service as these do not exist anymore. - spec: drop timedate-add-support-for-openSUSE-version-of-etc-sysconfig.patch Yast was fixed to write all timezone changes exactly how timedated expects things to be done. - spec: remove handle-etc-HOSTNAME.patch, since late 2014 the netcfg package handles the migration from /etc/HOSTNAME to /etc/hostname and owns both files. -spec: remove boot.udev and systemd-journald.init as they currently serve no purpose. - suse-sysv-bootd-support.diff: Remove HAVE_SYSVINIT conditions, we are in sysvcompat-only codepath, also remove the code targetting other distributions, never compiled as the TARGET_$DISTRO macros are never defined. - systemd-powerd-initctl-support.patch guard with HAVE_SYSV_COMPAT - set-and-use-default-logconsole.patch: fix HAVE_SYSV_COMPAT guards - insserv-generator.patch: Only build when sysvcompat is enabled - vhangup-on-all-consoles.patch add a comment indicating this is a workaround for a kernel bug. - spec: Add option to allow disabling sysvinit compat at build time. - spec: Add option to enable resolved at build time. - spec: Remove all %ifs for !factory products, current systemd releases can neither be built nor installed in older products without upgrading several components of the base system. (removed: 1008-add-msft-compability-rules.patch was only for =< 13.1) - spec: remove all dummy "aliases" to /etc/init.d, that made sense only when those init scripts still existed. (dummy localfs.service source: gone) - systemd-sleep-grub: moved to the grub2 package where it belongs as a suspend/resume hook (SR#286533) (drops prepare-suspend-to-disk.patch) - remove LFS_CFLAGS from CFLAGS, never needed in systemd as it force feds config.h everywhere in the preprocessor cmdline.- Update to new upstream release 219 * systemd units can now be "unsupported" (like, for example, .device in a containers), similar to the "skipped" state in SUSE's prior sysvinit scripts. * tmpfiles gained the 'v' type for creating btrfs subvolumes. * tmpfiles gained the 'a' type for setting ACLs. * systemd-nspawn gained new switches: --ephemeral, --template * The /var/lib/containers location is deprecated and replaced by /var/lib/machines. * machinectl gained the copy-from and copy-to commands. * machinectl now knows a "bind" command (for use with nspawn) * new "systemd-importd" daemon to download container images and run them as nspawn containers. * networkd collects LLDP network announcements, if available, and so shown in networkctl. * The fallback terminal type was changed from "vt102" to "vt220", allowing PgUp/PgDn keys to work. * Pressing Ctrl-Alt-Del 7x in 2 seconds forces a umount+reboot now, useful should the regular shutdown hang. * Removing storage will cause systemd to unmount the associated mountpoints so that they don't linger around.- Add suse-sysv-bootd-support.diff (reinstate old Revert-service-drop-support-for-SysV-scripts-for-the-early.patch)- Update to systemd v218-1050-g38ab096 - Remove patches use-usr-sbin-sulogin-for-emergency-service.patch (upstream fixed it) - Reinstate and improve (remove huge indents from) tty-ask-password-agent-on-console.patch, 0014-journald-with-journaling-FS.patch, rootsymlink_generator.- disable systemd-resolved for now as it interacts not well with our methods and security has concerns regarding spoofing. bsc#917781- Add patch kbd-model-map.patch to add missed keyboard layouts which are offered by YaST2 (bsc#910643 and boo#897803)- Update to new upstream release 218 * New utilities: systemd-timesyncd (SNTP client), systemd-resolved, systemd-networkd, networkctl, systemd-sysusers * machinectl gained a "poweroff" command for clean container shutdown * The udev hwdb now contains DPI information for mice. * Userspace firmware loading support has been removed and the minimum supported kernel version is thus bumped to 3.7. - Remove patches: G=gone locally, is upstream; D=dropped: no longer needed; N=no longer applies to source nor is it deemed needed; K=killed: no longer applicable and too complex to resolve: - --- G 0002-rfkill-rework-how-we-generate-file-names-from-rfkill.patch G avoid-assertion-if-invalid-address-familily-is-passed-to-g.patch K service-flags-sysv-service-with-detected-pid-as-RemainAfte.patch K remain_after_exit-initscript-heuristic-and-add-new-LSB-hea.patch K handle-SYSTEMCTL_OPTIONS-environment-variable.patch K 0018-Make-LSB-Skripts-know-about-Required-and-Should.patch K log-target-null-instead-kmsg.patch K tty-ask-password-agent-on-console.patch K 513-nspawn-veth.patch K 1087-infinit-timeout-for-kmod-loaded-modules.patch D module-load-handle-SUSE-etc-sysconfig-kernel-module-list.patch D avoid-leaking-socket-descriptors.patch D 0001-make-fortify-happy-with-ppoll.patch N fix-owner-of-var-log-btmp.patch N disable-nss-myhostname-warning-bnc-783841.patch N Revert-service-drop-support-for-SysV-scripts-for-the-early.patch N 0001-make-209-working-on-older-dist.patch N 0001-Don-t-snprintf-a-potentially-NULL-pointer.patch N tmpfiles-do-not-clean-for-mandb-index-files.patch G 0001-sd-bus-don-t-look-for-a-64bit-value-when-we-only-hav.patch G avoid-assertion-if-invalid-address-familily-is-passed-to-g.patc G optionally-warn-if-nss-myhostname-is-called.patch G 0001-units-systemd-sysctl.service.in-run-after-load-modul.patch G 0004-getty-generator-properly-escape-instance-names.patch G rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch G 0008-Reset-signal-mask-on-re-exec-to-init.patch G 0001-login-fix-pos-array-allocation.patch G 0002-login-set-pos-slot-to-fallback-on-pos-eviction.patch G 0003-login-Allow-calling-org.freedesktop.login1.Seat.Swit.patch G 0004-fix-typo-in-iDRAC-network-interface-name-irdac-idrac.patch G 0005-Replace-var-run-with-run-in-remaining-places.patch G 0006-Revert-back-to-var-run-at-a-couple-of-problems.patch G 0007-README-document-that-var-run-must-be-a-symlink-run.patch G 0008-Use-var-run-dbus-system_bus_socket-for-the-D-Bus-soc.patch G 0009-mount-don-t-send-out-PropertiesChanged-message-if-ac.patch G 0010-mount-don-t-fire-PropertiesChanged-signals-for-mount.patch G 0011-logs-show-fix-corrupt-output-with-empty-messages.patch G 0012-journalctl-refuse-extra-arguments-with-verify-and-si.patch G 0014-nspawn-fix-detection-of-missing-proc-self-loginuid.patch G 0001-Fix-systemd-stdio-bridge-symlink.patch G 0002-execute-free-directory-path-if-we-fail-to-remove-it-.patch G 0003-Do-not-print-invalid-UTF-8-in-error-messages.patch G 0004-man-document-missing-options-of-systemd-run.patch G 0005-systemd-run-add-some-extra-safety-checks.patch G 0006-journal-assume-that-next-entry-is-after-previous-ent.patch G 0007-journal-forget-file-after-encountering-an-error.patch G 0008-core-correctly-unregister-PIDs-from-PID-hashtables.patch G 0009-logind-fix-reference-to-systemd-user-sessions.servic.patch G 0010-man-update-link-to-LSB.patch G 0011-man-systemd-bootchart-fix-spacing-in-command.patch G 0012-man-add-missing-comma.patch G 0013-units-Do-not-unescape-instance-name-in-systemd-backl.patch G 0001-core-busname-add-lookup-string-for-BUSNAME_FAILURE_S.patch G 0002-manager-flush-memory-stream-before-using-the-buffer.patch G 0003-busname-don-t-drop-service-from-the-result-string.patch G 0004-fix-off-by-one-error-in-array-index-assertion.patch G 0005-logind-fix-policykit-checks.patch G 0006-rules-mark-loop-device-as-SYSTEMD_READY-0-if-no-file.patch G 0008-man-multiple-sleep-modes-are-to-be-separated-by-whit.patch G 0001-gpt-auto-generator-don-t-return-OOM-on-parentless-de.patch G 0002-bus-fix-memory-leak-when-kdbus-is-not-enabled.patch G 0006-Do-not-return-1-EINVAL-on-allocation-error.patch G 0007-networkd-fix-typo.patch G 0008-sd-bus-don-t-access-invalid-memory-if-a-signal-match.patch G 0009-sd-bus-don-t-choke-if-somebody-sends-us-a-message-wi.patch G 0012-journald-remove-stray-reset-of-error-return-value.patch G 0013-core-libsystemd-systemd-timedate-udev-spelling-fixes.patch G 0001-cgroup-it-s-not-OK-to-invoke-alloca-in-loops.patch G 0002-machined-fix-Kill-bus-call-on-machine-objects-when-w.patch G 0003-sd-bus-don-t-use-assert_return-to-check-for-disconne.patch G 0004-core-don-t-try-to-relabel-mounts-before-we-loaded-th.patch G 0005-sd-daemon-fix-incorrect-variable-access.patch G 0006-sd-event-initialization-perturbation-value-right-bef.patch G 0007-sd-event-don-t-accidentally-turn-of-watchdog-timer-e.patch G 0008-systemctl-kill-mode-is-long-long-gone-don-t-mention-.patch G 0009-ask-password-when-the-user-types-a-overly-long-passw.patch G 0001-journal-fix-export-of-messages-containing-newlines.patch G 0002-systemctl-update-NAME-to-PATTERN-in-help.patch G 0003-tty-ask-password-agent-return-negative-errno.patch G 0004-systemd-python-use-.hex-instead-of-.get_hex.patch G 0005-systemd-python-fix-failing-assert.patch G 0007-dbus-suppress-duplicate-and-misleading-messages.patch G 0001-reduce-the-amount-of-messages-logged-to-dev-kmsg-whe.patch G 0001-bash-completion-fix-__get_startable_units.patch G 0002-sysctl-replaces-some-slashes-with-dots.patch G 0003-delta-do-not-use-unicode-chars-in-C-locale.patch G 0004-implement-a-union-to-pad-out-file_handle.patch G shut-up-annoying-assertion-monotonic-clock-message.patch G 0001-sd-rtnl-message-append-fix-uninitialized-memory.patch G 0001-tmpfiles-fix-permissions-on-new-journal-files.patch G 0001-errno-make-sure-to-handle-the-3-errnos-that-are-alia.patch G 0003-analyze-fix-plot-with-bad-y-size.patch G 0004-job-add-waiting-jobs-to-run-queue-in-unit_coldplug.patch G 0005-job-always-add-waiting-jobs-to-run-queue-during-cold.patch G 0001-backlight-Avoid-restoring-brightness-to-an-unreadabl.patch G 0002-backlight-do-nothing-if-max_brightness-is-0.patch G 0003-backlight-unify-error-messages.patch G 0004-backlight-warn-if-kernel-exposes-backlight-device-wi.patch G 0005-backlight-handle-saved-brightness-exceeding-max-brig.patch G 0001-replace-more-dup-by-F_DUPFD_CLOEXEC.patch G 0002-pam_systemd-use-F_DUPFD_CLOEXEC-when-dupping-session.patch G 0001-core-close-socket-fds-asynchronously.patch G 0002-logind-bring-polkit-policy-for-hibernate-in-line-wit.patch G 0003-core-make-sure-to-serialize-jobs-for-all-units.patch G 0001-logind-ignore-lid-switch-if-more-than-1-display-is-c.patch G 0002-logind-fix-printf-format.patch G 0003-logind-ignore-lid-switch-events-for-30s-after-each-s.patch G 0004-logind-Do-not-fail-display-count-if-a-device-has-no-.patch G 0005-logind-move-lid-switch-handling-from-logind-main-to-.patch G 0006-man-clarify-that-the-ExecReload-command-should-be-sy.patch G 0007-man-readahead-fix-cmdline-switch-inconsistency-betwe.patch G 0008-man-update-journald-rate-limit-defaults.patch G 0009-nspawn-properly-format-container_uuid-in-UUID-format.patch G 0010-logind-allow-suspending-if-there-are-no-displays.patch G 0001-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0002-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0003-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0004-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0005-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-conf-parser-silently-ignore-sections-starting-with-X.patch G 0002-man-note-that-entire-sections-can-now-be-ignored.patch G 0004-machined-make-sure-GetMachineAddresses-is-available-.patch G 0005-core-Filter-by-state-behind-the-D-Bus-API-not-in-the.patch G 0006-login-add-mir-to-the-list-of-session-types.patch G 0007-logind-fix-Display-property-of-user-objects.patch G 0001-hwdb-update.patch G 0002-hwdb-update.patch G 0003-hwdb-PCI-include-primary-model-string-in-subsystem-m.patch G 0004-hwdb-update.patch G 0005-hwdb-update.patch G 0001-journal-cleanup-up-error-handling-in-update_catalog.patch G 0002-journal-properly-detect-language-specified-in-line.patch G 0003-man-mention-XDG_CONFIG_HOME-in-systemd.unit.patch G 0001-keymap-Add-Lenovo-Enhanced-USB-Keyboard.patch G 0002-keymap-Asus-EeePC-touchpad-toggle-key.patch G 0001-nspawn-allow-to-bind-mount-journal-on-top-of-a-non-e.patch G 0002-nspawn-restore-journal-directory-is-empty-check.patch G 0003-core-never-consider-failure-when-reading-drop-ins-fa.patch G 0004-socket-properly-handle-if-our-service-vanished-durin.patch G 0001-Do-not-unescape-unit-names-in-Install-section.patch G 0002-analyze-run-use-bus_open_transport_systemd-instead-o.patch G 0001-virt-rework-container-detection-logic.patch G 0002-fsck-include-device-name-in-the-message-about-missin.patch G 0003-units-use-KillMode-mixed-for-systemd-nspawn-.service.patch G 0004-util-ignore_file-should-not-allow-files-ending-with.patch G 0006-tty-ask-password-agent-Do-tell-what-directory-we-fai.patch G 0007-keyboard-add-Plantronics-.Audio-mute-button.patch G 0001-build-sys-use-glibc-s-xattr-support-instead-of-requi.patch G 0001-hwdb-fix-case-sensitive-match.patch G 0001-sd-event-restore-correct-timeout-behaviour.patch G 0002-bus-make-use-of-sd_bus_try_close-in-exit-on-idle-ser.patch G 0001-umount-modernizations.patch G 0002-namespace-when-setting-up-an-inaccessible-mount-poin.patch G 0003-core-allow-transient-mount-units.patch G 0004-systemd-detect-virt-only-discover-Xen-domU.patch G 0005-backlight-Do-not-clamp-brightness-for-LEDs.patch G 0006-log-honour-the-kernel-s-quiet-cmdline-argument.patch G 0001-core-fix-invalid-free-in-killall.patch G 0003-install-fix-invalid-free-in-unit_file_mask.patch G 0001-systemd-detect-virt-detect-s390-virtualization.patch G 0001-core-sysvcompat-network-should-be-equivalent-to-netw.patch G 0002-units-add-missing-caps-so-that-GetAddresses-can-work.patch G 0003-units-order-systemd-tmpfiles-clean.service-after-tim.patch G 0005-po-add-Greek-translation.patch G 0006-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0007-po-add-German-translation.patch G 0009-core-clean-up-signal-reset-logic-when-reexec.patch G 0010-util-treat-fuse.sshfs-as-a-network-filesystem.patch G 0011-build-sys-add-pthread-flag-for-libsystemd-shared.patch G 0012-core-transaction-avoid-misleading-error-message-when.patch G 0001-vconsole-also-copy-character-maps-not-just-fonts-fro.patch G 0002-core-make-sure-Environment-fields-passed-in-for-tran.patch G 0003-core-You-can-not-put-the-cached-result-of-use_smack-.patch G 0004-cryptsetup-don-t-add-unit-dependency-on-dev-null-dev.patch G 0005-man-fix-path-in-crypttab-5.patch G 0001-units-order-network-online.target-after-network.targ.patch G 0001-core-use-correct-format-string-for-UIDs.patch G 0002-core-transaction-fix-cycle-break-attempts-outside-tr.patch G 0003-fsck-consider-a-fsck-implementation-linked-to-bin-tr.patch G 0001-main-uid_to_name-might-fail-due-to-OOM-protect-again.patch G 0002-journald-make-MaxFileSec-really-default-to-1month.patch G 0003-units-remove-RefuseManualStart-from-units-which-are-.patch G 0004-util-refuse-considering-UID-0xFFFF-and-0xFFFFFFFF-va.patch G 0005-nspawn-block-open_by_handle_at-and-others-via-seccom.patch G 0006-tmpfiles-don-t-do-automatic-cleanup-in-XDG_RUNTIME_D.patch G 0007-units-skip-mounting-tmp-if-it-is-a-symlink.patch G 0001-parse_uid-return-ENXIO-for-1-uids.patch G 0002-util-when-unescaping-strings-don-t-allow-smuggling-i.patch G 0003-localed-consider-an-unset-model-as-a-wildcard.patch G 0004-sd-bus-when-an-event-loop-terminates-explicitly-clos.patch G 0005-bus-close-a-bus-that-failed-to-connect.patch G 0006-hwdb-update.patch G 0007-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-architecture-Add-tilegx.patch G 0002-architecture-Add-cris.patch G 0003-arch-add-crisv32-to-uname-check.patch G 0004-architecture-remove-cris-from-uname-list.patch G 0003-namespace-make-sure-tmp-var-tmp-and-dev-are-writable.patch G 0002-namespace-fix-uninitialized-memory-access.patch G 0001-machine-don-t-return-uninitialized-variable.patch G 0002-vconsole-setup-run-setfont-before-loadkeys.patch G 0001-util-consider-0x7F-a-control-chracter-which-it-is-DE.patch G 0002-util-don-t-consider-tabs-special-in-string_has_cc-an.patch G 0003-architecture-add-string-table-entries-for-mips-le-ar.patch G 0004-core-Added-support-for-ERRNO-NOTIFY_SOCKET-message-p.patch G 0005-service-don-t-accept-negative-ERRNO-notification-mes.patch G 0006-systemctl-show-StatusErrno-value-in-systemctl-status.patch G 0007-service-flush-status-text-and-errno-values-each-time.patch G 0001-journal-compress-return-early-in-uncompress_startswi.patch G 0002-journal-compress-improve-xz-compression-performance.patch G 0001-logind-allow-switching-to-unused-VTs-via-SwitchTo.patch G 0002-hostnamed-add-a-new-chassis-type-for-watches.patch G 0001-units-make-ExecStopPost-action-part-of-ExecStart.patch G 0001-event-pull-in-sd-event.h-from-event-util.h.patch G 0002-util-fix-has-cc-check-and-add-test.patch G 0003-sd-event-always-call-epoll_ctl-on-mask-updates-if-ed.patch G 0004-fileio-quote-more-shell-characters-in-envfiles.patch G 0001-Clear-up-confusion-wrt.-ENTRY_SIZE_MAX-and-DATA_SIZE.patch G 0002-units-serial-getty-.service-use-the-default-RestartS.patch G 0001-po-add-Ukrainian-translation.patch G 0002-man-document-yearly-and-annually-in-systemd.time-7.patch G 0003-core-nicer-message-when-inotify-watches-are-exhauste.patch G 0001-detect-virt-Fix-Xen-domU-discovery.patch G 0002-Be-more-verbose-when-bind-or-listen-fails.patch G 0003-Add-quotes-to-warning-message.patch G 0004-systemd-return-the-first-error-from-manager_startup.patch G 0001-bash-completion-p-option-for-journalctl.patch G 0002-journalctl-man-allow-only-between-terms.patch G 0003-systemd-use-pager-for-test-and-help.patch G 0001-bus-proxyd-fix-incorrect-comparison.patch G 0002-shell-completion-prevent-mangling-unit-names.patch G 0003-Always-check-asprintf-return-code.patch G 0004-bash-completion-use-list-unit-files-to-get-all-units.patch G 0005-core-only-set-the-kernel-s-timezone-when-the-RTC-run.patch G 0006-parse_boolean-require-exact-matches.patch G 0007-drop_duplicates-copy-full-BindMount-struct.patch G 0008-shell-completion-prevent-mangling-unit-names-bash.patch G 0009-journald-always-add-syslog-facility-for-messages-com.patch G 0001-sysv-order-initscripts-which-provide-network-before-.patch G 0002-keymap-Add-microphone-mute-keymap-for-Dell-Latitude.patch G 0003-keymap-Annotate-all-micmute-workarounds.patch G 0007-hwdb-update.patch G 0001-nspawn-fix-truncation-of-machine-names-in-interface-.patch G 0002-switch-root-umount-the-old-root-correctly.patch G 0003-bootchart-it-s-not-OK-to-return-1-from-a-main-progra.patch G 0004-login-set_controller-should-fail-if-prepare_vt-fails.patch G 0005-sd-resolve-fix-allocation-if-query-ids-never-reuse-t.patch G 0006-login-share-VT-signal-handler-between-sessions.patch G 0007-journald-also-increase-the-SendBuffer-of-dev-log-to-.patch G 0008-mount-setup-fix-counting-of-early-mounts-without-SMA.patch G 0009-journald-Fix-off-by-one-error-in-Missed-X-kernel-mes.patch G 0010-machine_kill-Don-t-kill-the-unit-when-killing-the-le.patch G 0011-units-fix-BindsTo-logic-when-applied-relative-to-ser.patch G 0012-util-try-to-be-a-bit-more-NFS-compatible-when-checki.patch G 0001-hwdb-keymaps-for-Samsung-900X3E-900X3F.patch G 0002-Add-hwdb-entry-for-Samsung-Series-7-Ultra.patch G 0003-keymap-Fix-HP-Pavillon-DV7.patch G 0004-hwdb-update-format-description-and-document-reloadin.patch G 0008-hwdb-update.patch G 0001-systemctl-Correct-error-message-printed-when-bus_pro.patch G 0002-units-order-systemd-fsck-.service-after-local-fs-pre.patch G 0003-keymap-Adjust-for-more-Samsung-900X4-series.patch G 0001-login-fix-memory-leak-on-DropController.patch G 0002-util-fix-minimal-race-where-we-might-miss-SIGTERMs-w.patch G 0003-sd-journal-properly-convert-object-size-on-big-endia.patch G 0004-sd-journal-verify-that-object-start-with-the-field-n.patch G 0001-nspawn-fix-network-interface.patch G 0001-completion-filter-templates-from-restartable-units.patch G 0002-systemd-fix-error-message.patch G 0003-Quote-unit-names-in-suggested-systemctl-commandlines.patch G 0004-config-parser-fix-mem-leak.patch G 0005-login-fix-mem-leak.patch G 0001-login-simplify-controller-handling.patch G 0001-initrd-parse-etc.service-ignore-return-code-of-daemo.patch G 0008-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0009-hwdb-update.patch G 0001-systemctl-allow-to-change-the-default-target-without.patch G 0001-activate-fix-fd-leak-in-do_accept.patch G 0002-analyze-avoid-a-null-dereference.patch G 0003-analyze-fix-mem-leak.patch G 0004-backlight-Avoid-error-when-state-restore-is-disabled.patch G 0005-bus-avoid-using-m-kdbus-after-freeing-it.patch G 0006-bus-unref-buscreds-on-failure.patch G 0007-core-fix-a-potential-mem-leak.patch G 0008-core-smack-setup-Actually-allow-for-succesfully-load.patch G 0009-journal-do-not-leak-mmaps-on-OOM.patch G 0010-manager-use-correct-cleanup-function.patch G 0001-core-fix-resource-leak-in-manager_environment_add.patch G 0002-util-remove-a-unnecessary-check.patch G 0003-udev-event-explicitly-don-t-read-from-invalid-fd.patch G 0004-shared-conf-parser.patch G 0005-logind-fix-typo.patch G 0006-systemctl-fix-resource-leak-CID-1237747.patch G 0007-libudev-monitor-warn-if-we-fail-to-request-SO_PASSCR.patch G 0008-shared-conf-parser-don-t-leak-memory-on-error-in-DEF.patch G 0009-bus-fix-bus_print_property-to-use-int-for-booleans.patch G 0001-journal-Do-not-count-on-the-compiler-initializing-fo.patch G 0002-include-fcntl.h-rather-than-sys-fcntl.h.patch G 0003-mount-order-options-before-other-arguments-to-mount.patch G 0004-shared-wtmp-utmp-don-t-clear-store_wtmp-in-utmp_put_.patch G 0005-shared-label.h-add-missing-stdio.h-include.patch G 0006-shared-sparse-endian.h-add-missing-byteswap.h-includ.patch G 0001-login-pause-devices-before-acknowledging-VT-switches.patch G 0001-nspawn-don-t-try-to-create-veth-link-with-too-long-i.patch G 0001-socket-introduce-SELinuxContextFromNet-option.patch G 0002-util-avoid-non-portable-__WORDSIZE.patch G 0001-Fix-warning-about-unused-variable-with-SELINUX.patch G 0002-bus-remove-unused-check.patch G 0001-systemd-tmpfiles-Fix-IGNORE_DIRECTORY_PATH-age-handl.patch G 0001-logind-add-support-for-Triton2-Power-Button.patch G 0002-logind-add-support-for-TPS65217-Power-Button.patch G 0001-shutdownd-clean-up-initialization-of-struct.patch G 0003-bootchart-parse-userinput-with-safe_atoi.patch G 0004-bootchart-check-return-of-strftime.patch G 0005-bootchart-Do-not-try-to-access-data-for-non-existing.patch G 0001-journalctl-do-not-output-reboot-markers-when-running.patch G 0002-udev-hwdb-New-Entry-for-Dell-XPS12-9Q33-keyboard.patch G 0001-core-swap-only-make-configured-units-part-of-swap.ta.patch G 0009-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-virt-detect-that-we-are-running-inside-the-docker-co.patch G 0002-bootchart-use-n-a-if-PRETTY_NAME-is-not-found.patch G 0003-fileio-label-return-error-when-writing-fails.patch G 0001-sd-event-don-t-require-a-signal-event-source-to-be-e.patch G 0004-sd-event-check-the-value-of-received-signal.patch G 0005-sd-id128-do-stricter-checking-of-random-boot-id.patch G 0001-keymap-Fix-touchpad-toggle-on-Toshiba-Satellite-P75-.patch G 0001-units-introduce-network-pre.target-as-place-to-hook-.patch G 0002-keymap-Fix-touchpad-toggle-key-on-Asus-laptops.patch G 0003-sd-bus-check-return-value-of-vasprintf.patch G 0004-core-map-the-rescue-argument-to-rescue.target.patch G 0005-util-avoid-double-close-of-fd.patch G 0001-systemctl-when-mangle-unit-names-for-the-isolate-suf.patch G 0001-tmpfiles-compare-return-against-correct-errno.patch G 0001-shell-completion-fix-completion-of-inactive-units.patch G 0002-shell-completion-propose-templates-for-disable-re-en.patch G 0003-man-we-don-t-have-Wanted-dependency.patch G 0004-selinux-fix-potential-double-free-crash-in-child-pro.patch G 0001-systemd-continue-switch-root-even-if-umount-fails.patch G 0002-systemd-try-harder-to-bind-to-notify-socket.patch G 0001-strv-add-an-additional-overflow-check-when-enlarging.patch G 0002-hwdb-Add-mapping-for-special-keys-on-compaq-ku-0133-.patch G 0003-journald-add-CAP_MAC_OVERRIDE-in-journald-for-SMACK-.patch G 0004-journal-do-server_vacuum-for-sigusr1.patch G 0005-cryptsetup-fix-an-OOM-check.patch G 0002-shutdown-pass-own-argv-to-run-initramfs-shutdown.patch G 0001-manager-Linux-on-hppa-has-fewer-rtsigs-hence-avoid-u.patch G 0002-time-also-support-infinity-syntax-in-parse_nsec.patch G 0003-time-earlier-exit-from-format_timestamp_relative-on-.patch G 0004-sd-bus-if-we-don-t-manage-to-properly-allocate-the-e.patch G 0005-journalctl-correct-help-text-for-until.patch G 0006-calendarspec-fix-typo-in-annually.patch G 0007-systemctl-do-not-ignore-errors-in-symlink-removal.patch G 0008-util-introduce-sethostname_idempotent.patch G 0009-util-fix-copy-paste-error-and-actually-set-the-new-h.patch G 0010-shutdown-do-final-unmounting-only-if-not-running-ins.patch G 0011-selinux-make-sure-we-do-not-try-to-print-missing-fie.patch G 0012-manager-do-not-print-anything-while-passwords-are-be.patch G 0001-sd-bus-properly-handle-removals-of-non-existing-matc.patch G 0002-keymap-Ignore-brightness-keys-on-Dell-Inspiron-1520-.patch G 0001-core-don-t-allow-enabling-if-unit-is-masked.patch G 0002-snapshot-return-error-when-snapshot-exists.patch G 0003-shared-install-avoid-prematurely-rejecting-missing-u.patch G 0004-Raise-level-of-Found-dependency.-lines.patch G 0005-units-order-sd-journal-flush-after-sd-remount-fs.patch G 0006-journald-fix-minor-memory-leak.patch G 0007-journald-also-check-journal-file-size-to-deduce-if-i.patch G 0008-journald-fix-memory-leak-on-error-path.patch G 0009-units-make-systemd-journald.service-Type-notify.patch G 0010-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-login-rerun-vconsole-setup-when-switching-from-vgaco.patch G 0002-shutdown-fix-arguments-to-run-initramfs-shutdown.patch G 0003-utf8-when-looking-at-the-next-unichar-honour-the-siz.patch G 0001-keymap-Add-support-for-IBM-ThinkPad-X41-Tablet.patch G 0002-keymap-Fix-special-keys-on-ThinkPad-X60-X61-Tablet.patch G 0001-systemctl-let-list-units-unit-files-honour-type.patch G 0002-systemctl-obey-state-in-list-unit-files.patch G 0002-core-watchdog-bus-properties-cannot-be-both-writable.patch G 0003-sd-bus-refuse-properties-that-claim-to-be-both-writa.patch G 0001-units-make-sure-rfkill-service-is-bount-to-the-actua.patch G 0001-selinux-access-fix-broken-ternary-operator.patch G 0002-systemctl-show-BindsTo-BoundBy-in-list-dependencies.patch G 0003-cryptsetup-default-to-no-hash-when-keyfile-is-specif.patch G 0004-core-fix-transaction-destructiveness-check-once-more.patch G 0001-units-tmpfiles-setup-dev-allow-unsafe-file-creation-.patch G 0002-man-tmpfiles.d-recommend-using-b-and-c.patch G 1009-cdrom_id-use-the-old-MMC-fallback.patch G 1010-udev-increase-result-size-for-programs.patch G 1014-udev-update-net_id-comments.patch G 1015-udev-persistent-naming-we-cannot-use-virtio-numbers-.patch G 1016-udev-warn-when-name_to_handle_at-is-not-implemented.patch G 1017-udev-serialize-synchronize-block-device-event-handli.patch G 1018-udev-do-not-skip-the-execution-of-RUN-when-renaming-.patch G 1019-udev-avoid-use-of-uninitialized-err.patch G 1020-udev-keyboard-also-hook-into-change-events.patch G 1022-udev-remove-seqnum-API-and-all-assumptions-about-seq.patch G 1023-udev-builtin-keyboard-do-tell-on-which-device-EVIOCS.patch G 1024-udev-always-close-lock-file-descriptor.patch G 1025-udev-exclude-device-mapper-from-block-device-ownersh.patch G 1026-udevd-inotify-modernizations.patch G 1027-udev-synthesize-change-events-for-partitions-when-to.patch G 1028-udev-link-config-fix-mem-leak.patch G 1029-udev-try-first-re-reading-the-partition-table.patch G 1030-udev-guard-REREADP-logic-with-open-O_ECXL.patch G 1031-udev-make-sure-we-always-get-change-for-the-disk.patch G 1032-udev-guard-REREADPT-by-exclusive-lock-instead-of-O_E.patch G 1033-udev-really-exclude-device-mapper-from-block-device.patch G 1034-udev-check-the-return-value-from-udev_enumerate_scan.patch G 1038-udev-fix-invalid-free-in-enable_name_policy.patch G 1039-udevadm-settle-fixed-return-code-for-empty-queue.patch G 1041-libudev-fix-udev_queue_get_queue_is_empty-logic.patch G 1042-libudev-queue-provide-file-descriptor-to-watch-busy-.patch G 1043-libudev-queue-watch-entire-directory-to-allow-the-re.patch G 1044-rules-update-qemu-hid-rules.patch G 1045-rules-don-t-enable-usb-pm-for-Avocent-devices.patch G 1047-udev-net_setup_link-builtin-should-print-the-reason-.patch G 1048-udev-net_setup_link-add-a-bit-more-logging.patch G 1049-udev-link_config-ignore-errors-due-to-missing-MAC-ad.patch G 1052-rules-uaccess-add-ID_SOFTWARE_RADIO.patch G 1054-udev-exclude-MD-from-block-device-ownership-event-lo.patch G 1056-udevd-add-event-timeout-commandline-option.patch G 1057-udev-unify-event-timeout-handling.patch G 1058-udev-unify-event-timeout-handling.patch G 1059-udev-fixup-commit-dd5eddd28a74a49607a8fffcaf960040db.patch G 1061-rules-allow-systemd-to-manage-loop-device-partitions.patch G 1063-udev-path_id-suppress-ID_PATH-for-devices-with-an-un.patch G 1064-udev-hwdb-do-not-look-at-usb_device-parents.patch G 1065-udev-bump-event-timeout-to-60-seconds.patch G 1067-udev-always-resolve-correctly-database-names-on-chan.patch G 1068-udev-net_setup_link-export-the-.link-filename-applie.patch G 1069-rules-net-setup-link-preserve-ID_NET_LINK_FILE-and-I.patch G 1070-rules-net-setup-link-remove-stray-linebreak.patch G 1071-udev-import-the-full-db-on-MOVE-events-for-devices-w.patch G 1072-udev-netif_rename-don-t-log-to-kmsg.patch G 1073-udev-drop-print_kmsg.patch G 1074-udev-fix-copy-paste-error-in-log-message.patch G 1075-udev-timeout-increase-timeout.patch G 1076-udev-timeout-warn-after-a-third-of-the-timeout-befor.patch G 1077-udev-timeout-warn-after-a-third-of-the-timeout-befor.patch G 1078-udev-remove-userspace-firmware-loading-support.patch G 1079-udev-remove-userspace-firmware-loading-support.patch G 1080-udevd-parse_argv-warn-if-argumens-are-invalid.patch G 1081-udevd-check-return-of-various-functions.patch G 1082-udevadm-hwdb-check-return-value-of-fseeko.patch G 1083-udev-node-warn-if-chmod-chown-fails.patch G 1084-udev-ctrl-log-if-setting-SO_PASSCRED-fails.patch G 1085-udev-fix-typos.patch G 1086-udevd-don-t-fail-if-run-udev-exists.patch G 1089-fix-cgroup-device-controller.patch G 1090-udev-path_id-set-supported_parent-for-well-known-SCS.patch G 1091-udev-path_id-update-comments.patch G 1092-libudev-do-not-accept-invalid-log-levels.patch G 1093-udev-Fix-parsing-of-udev.event-timeout-kernel-parame.patch G 1094-udev-avoid-magic-constants-in-kernel-cmdline-parsers.patch G 1098-udev-link_setup-respect-kernel-name-assign-policy.patch- update set-and-use-default-logconsole.patch - fix comparison of console log facility that caused journald to skip output to console (boo#912030)- Use Robert's latest patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch which drops NAMEPOLICY_KERNEL as this breaks all on current systems out there- remove 0022-systemd-tmpfiles-ownerkeep.patch since this is now implemented into the systemd-tmpfiles binary - add user based ignore statements in tmpfiles removal directives (bnc#903009) add systemd-add-user-keep.patch- use --boot option in systemd-tmpfiles-setup-dev.service (bnc#908476) add upstream patches: 0001-units-tmpfiles-setup-dev-allow-unsafe-file-creation-.patch 0002-man-tmpfiles.d-recommend-using-b-and-c.patch (adapted)- Update patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch to Robert's version- Add upstream patches 0001-selinux-access-fix-broken-ternary-operator.patch 0002-systemctl-show-BindsTo-BoundBy-in-list-dependencies.patch 0003-cryptsetup-default-to-no-hash-when-keyfile-is-specif.patch 0004-core-fix-transaction-destructiveness-check-once-more.patch - Avoid old net devices naming scheme on openSUSE 13.2 and less maybe caused by patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch- fix systemd-nspawn network-veth support (bnc#906709) add 513-nspawn-veth.patch- Add upstream patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch which may solve bsc#907318- Add upstream patches 0001-units-make-sure-rfkill-service-is-bount-to-the-actua.patch 0002-rfkill-rework-how-we-generate-file-names-from-rfkill.patch- Change the maximum number of children from CPU_COUNT * 256 to CPU_COUNT * 64. Update 1097-udevd-increase-maximum-number-of-children.patch- Increase number of children/workers to CPU_COUNT * 256 to avoid 'maximum number of children reached' (bnc#907393). Add 1097-udevd-increase-maximum-number-of-children.patch- Fix error return in rootsymlink_generator.c Update 1096-new-udev-root-symlink-generator.patch- Remove upstream patch 0001-systemd-logind.service-set-Type-notify.patch as systemd-logind.service is already from DBus type, compare with upstream commit eab459bc0639b81b32735f36d3e929e4bfa2cb4b- Add upstream patches 0001-systemd-logind.service-set-Type-notify.patch 0002-core-watchdog-bus-properties-cannot-be-both-writable.patch 0003-sd-bus-refuse-properties-that-claim-to-be-both-writa.patch- Re-add directory /usr/lib/systemd/system/basic.target.wants- remove pm-utils-hooks-compat.sh again, pm-utils built-in hooks partially duplicate hooks run by systemd which may potentially lead to problems, instead temporarily re-enable Forward-suspend-hibernate-calls-to-pm-utils.patch until boo#904828 can be addressed properly- fix bashisms in write_net_rules script - update patches: * 1053-better-checks-in-write_net_rules.patch- Add upstream patches 0001-systemctl-let-list-units-unit-files-honour-type.patch 0002-systemctl-obey-state-in-list-unit-files.patch which allows to use --type in the systemctl command list-units and list-unit-files.- Add upstream patches 0001-keymap-Add-support-for-IBM-ThinkPad-X41-Tablet.patch 0002-keymap-Fix-special-keys-on-ThinkPad-X60-X61-Tablet.patch- New root symlink rule generator Add 1096-new-udev-root-symlink-generator.patch - Remove write_dev_root_rule and systemd-udev-root-symlink- Change patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch to skip hdflush as well as hddown but only use halt as fallback for poweroff as well as synch in systemctl before any reboot command (compare with commit 4a3ad39957399c4a30fc472a804e72907ecaa4f9)- Create rule to set I/O scheduler to deadline if device attribute 'rotational' equals 0, usually SSDs (bnc#904517). Add 1095-set-ssd-disk-to-use-deadline-scheduler.patch- fix systemd-fstab-generator crypttab parsing (bnc#903963)- Add pm-utils-hooks-compat.sh in order to run pm-utils sleep hooks from systemd (boo#904828)- Add upstream patches 0001-login-rerun-vconsole-setup-when-switching-from-vgaco.patch 0002-shutdown-fix-arguments-to-run-initramfs-shutdown.patch 0003-utf8-when-looking-at-the-next-unichar-honour-the-siz.patch- Add upstream patches 0001-core-don-t-allow-enabling-if-unit-is-masked.patch 0002-snapshot-return-error-when-snapshot-exists.patch 0003-shared-install-avoid-prematurely-rejecting-missing-u.patch 0004-Raise-level-of-Found-dependency.-lines.patch 0005-units-order-sd-journal-flush-after-sd-remount-fs.patch 0006-journald-fix-minor-memory-leak.patch 0007-journald-also-check-journal-file-size-to-deduce-if-i.patch 0008-journald-fix-memory-leak-on-error-path.patch 0009-units-make-systemd-journald.service-Type-notify.patch 0010-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Add upstream patches 1092-libudev-do-not-accept-invalid-log-levels.patch 1093-udev-Fix-parsing-of-udev.event-timeout-kernel-parame.patch 1094-udev-avoid-magic-constants-in-kernel-cmdline-parsers.patch- Add patch watch_resolv.conf_for_become_changed.patch to add an inotify watch on /etc/resolv.conf which enables the reload of a changed resolver configuration on the fly (bsc#902901) - Do not apply patch 0022-systemd-tmpfiles-ownerkeep.patch in case if the script /usr/bin/systemd-tmpfiles-keep is missed- Add upstream patches 0001-sd-bus-properly-handle-removals-of-non-existing-matc.patch 0002-keymap-Ignore-brightness-keys-on-Dell-Inspiron-1520-.patch- Add upstream patches 1090-udev-path_id-set-supported_parent-for-well-known-SCS.patch 1091-udev-path_id-update-comments.patch which will be applied if patch 1090-udev-path_id-set-supported_parent-for-well-known-SCS.patch is applied a this may fix the trouble with iSCSI (bnc#898233)- Add upstream patches 0001-manager-Linux-on-hppa-has-fewer-rtsigs-hence-avoid-u.patch 0002-time-also-support-infinity-syntax-in-parse_nsec.patch 0003-time-earlier-exit-from-format_timestamp_relative-on-.patch 0004-sd-bus-if-we-don-t-manage-to-properly-allocate-the-e.patch 0005-journalctl-correct-help-text-for-until.patch 0006-calendarspec-fix-typo-in-annually.patch 0007-systemctl-do-not-ignore-errors-in-symlink-removal.patch 0008-util-introduce-sethostname_idempotent.patch 0009-util-fix-copy-paste-error-and-actually-set-the-new-h.patch 0010-shutdown-do-final-unmounting-only-if-not-running-ins.patch 0011-selinux-make-sure-we-do-not-try-to-print-missing-fie.patch - Replace patch keep-crypt-password-prompt.patch as this with upstream patch 0012-manager-do-not-print-anything-while-passwords-are-be.patch- Add upstream patch 0002-shutdown-pass-own-argv-to-run-initramfs-shutdown.patch - Add patch journald-advice-about-use-of-memory.patch to use mmap() flags as well as madvise(2) for journal files.- Add upstream patches 0001-strv-add-an-additional-overflow-check-when-enlarging.patch 0002-hwdb-Add-mapping-for-special-keys-on-compaq-ku-0133-.patch 0003-journald-add-CAP_MAC_OVERRIDE-in-journald-for-SMACK-.patch 0004-journal-do-server_vacuum-for-sigusr1.patch 0005-cryptsetup-fix-an-OOM-check.patch- Add upstream patch 1089-fix-cgroup-device-controller.patch to avoid trouble on existing /dev/console with nspawn (bsc#902240)- Modify patch avoid-leaking-socket-descriptors.patch to close file descriptors for incomming connections in pam module in case of short memory.- Add upstream patches 0001-systemd-continue-switch-root-even-if-umount-fails.patch 0002-systemd-try-harder-to-bind-to-notify-socket.patch - Add patch avoid-leaking-socket-descriptors.patch to close file descriptors if an incomming connection can not be handled due e.g. short memory. Could be related to bsc #901481- Add upstream patches 0001-shell-completion-fix-completion-of-inactive-units.patch 0002-shell-completion-propose-templates-for-disable-re-en.patch 0003-man-we-don-t-have-Wanted-dependency.patch 0004-selinux-fix-potential-double-free-crash-in-child-pro.patch- Adapt patch rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch to make it work even with patch #438 and #439- Add upstream patches 0001-systemctl-when-mangle-unit-names-for-the-isolate-suf.patch 0001-tmpfiles-compare-return-against-correct-errno.patch- Add upstream patches 0001-keymap-Fix-touchpad-toggle-on-Toshiba-Satellite-P75-.patch 0001-units-introduce-network-pre.target-as-place-to-hook-.patch 0002-keymap-Fix-touchpad-toggle-key-on-Asus-laptops.patch 0003-sd-bus-check-return-value-of-vasprintf.patch 0004-core-map-the-rescue-argument-to-rescue.target.patch 0005-util-avoid-double-close-of-fd.patch- Add upstream patches 0001-virt-detect-that-we-are-running-inside-the-docker-co.patch 0002-bootchart-use-n-a-if-PRETTY_NAME-is-not-found.patch 0003-fileio-label-return-error-when-writing-fails.patch 0001-sd-event-don-t-require-a-signal-event-source-to-be-e.patch 0004-sd-event-check-the-value-of-received-signal.patch 0005-sd-id128-do-stricter-checking-of-random-boot-id.patch- Add upstream patches 0001-core-swap-only-make-configured-units-part-of-swap.ta.patch 0009-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Add upstream patches 0001-journalctl-do-not-output-reboot-markers-when-running.patch 0002-udev-hwdb-New-Entry-for-Dell-XPS12-9Q33-keyboard.patch- Add upstream patches 0001-logind-add-support-for-Triton2-Power-Button.patch 0002-logind-add-support-for-TPS65217-Power-Button.patch - Add upstream patches 0001-shutdownd-clean-up-initialization-of-struct.patch 0003-bootchart-parse-userinput-with-safe_atoi.patch 0004-bootchart-check-return-of-strftime.patch 0005-bootchart-Do-not-try-to-access-data-for-non-existing.patch- Revert patch 1063, which incorrectly disallows /dev/disk/by-path links for iSCSI (and other) devices. Will be corrected and re-added once upstream is consulted. (bnc#898233). Disable: 1063-udev-path_id-suppress-ID_PATH-for-devices-with-an-un.patc- Add upstream patch 0001-systemd-tmpfiles-Fix-IGNORE_DIRECTORY_PATH-age-handl.patch for bsc#893797- Drop renaming virtual interfaces in a guest (bnc#898432). Add 1088-drop-renaming-of-virtual-interfaces-in-guest.patch- Rename patch 0001-infinit-timeout-for-kmod-loaded-modules.patch to patch 1087-infinit-timeout-for-kmod-loaded-modules.patch and apply this one- Change patch 0003-mount-order-options-before-other-arguments-to-mount.patch to fix bsc#898240- Add upstream patches 0001-Fix-warning-about-unused-variable-with-SELINUX.patch 0002-bus-remove-unused-check.patch- Add patch 0001-infinit-timeout-for-kmod-loaded-modules.patch to be able to avoid killing a running kmod/modprobe (bnc#889297)- Update patch 0001-bnc888612-logind-polkit-acpi.patch- Add upstream patches 0001-login-pause-devices-before-acknowledging-VT-switches.patch May help that history of the shell is saved 0001-nspawn-don-t-try-to-create-veth-link-with-too-long-i.patch 0001-socket-introduce-SELinuxContextFromNet-option.patch (bsc#897801) 0002-util-avoid-non-portable-__WORDSIZE.patch- Add patch 0001-bnc888612-logind-polkit-acpi.patch from Frederic to solve bnc#888612 - AUDIT-0: Power button press at gdm login should not prompt for credentials- Add upstream bugfix patches 0001-journal-Do-not-count-on-the-compiler-initializing-fo.patch 0002-include-fcntl.h-rather-than-sys-fcntl.h.patch 0003-mount-order-options-before-other-arguments-to-mount.patch 0004-shared-wtmp-utmp-don-t-clear-store_wtmp-in-utmp_put_.patch 0005-shared-label.h-add-missing-stdio.h-include.patch 0006-shared-sparse-endian.h-add-missing-byteswap.h-includ.patch 0007-libudev-monitor-warn-if-we-fail-to-request-SO_PASSCR.patch 0008-shared-conf-parser-don-t-leak-memory-on-error-in-DEF.patch 1080-udevd-parse_argv-warn-if-argumens-are-invalid.patch 1081-udevd-check-return-of-various-functions.patch 1082-udevadm-hwdb-check-return-value-of-fseeko.patch 1083-udev-node-warn-if-chmod-chown-fails.patch 1084-udev-ctrl-log-if-setting-SO_PASSCRED-fails.patch 1085-udev-fix-typos.patch 1086-udevd-don-t-fail-if-run-udev-exists.patch- Add upstream bugfix patches 0001-core-fix-resource-leak-in-manager_environment_add.patch 0002-util-remove-a-unnecessary-check.patch 0003-udev-event-explicitly-don-t-read-from-invalid-fd.patch 0004-shared-conf-parser.patch 0005-logind-fix-typo.patch 0006-systemctl-fix-resource-leak-CID-1237747.patch 0007-libudev-monitor-warn-if-we-fail-to-request-SO_PASSCR.patch 0008-shared-conf-parser-don-t-leak-memory-on-error-in-DEF.patc 0009-bus-fix-bus_print_property-to-use-int-for-booleans.patch - Remove 0001-sizeof-bool-used-by-gcc-depends-on-arch.patch as 0009-bus-fix-bus_print_property-to-use-int-for-booleans.patch is the upstream solution- Add patch 0001-sizeof-bool-used-by-gcc-depends-on-arch.patch to fix for the size of the gcc builtin type bool also known as _Bool from the include header stdbool.h.- Add upstream patches as real fixes 0001-activate-fix-fd-leak-in-do_accept.patch 0002-analyze-avoid-a-null-dereference.patch 0003-analyze-fix-mem-leak.patch 0004-backlight-Avoid-error-when-state-restore-is-disabled.patch 0005-bus-avoid-using-m-kdbus-after-freeing-it.patch 0006-bus-unref-buscreds-on-failure.patch 0007-core-fix-a-potential-mem-leak.patch 0008-core-smack-setup-Actually-allow-for-succesfully-load.patch 0009-journal-do-not-leak-mmaps-on-OOM.patch 0010-manager-use-correct-cleanup-function.patch - Intergrate the work of Robert and rename the patch 1068-udev-remove-userspace-firmware-loading-support.patch to 1078-udev-remove-userspace-firmware-loading-support.patch Also add patch 1079-udev-remove-userspace-firmware-loading-support.patch to apply the same change for opensuse 13.2 and above- Add upstream patch 0001-systemctl-allow-to-change-the-default-target-without.patch to allow to override default target without --force (bnc#896664)- Add upstream patches for udev 1068-udev-net_setup_link-export-the-.link-filename-applie.patch 1069-rules-net-setup-link-preserve-ID_NET_LINK_FILE-and-I.patch 1070-rules-net-setup-link-remove-stray-linebreak.patch 1071-udev-import-the-full-db-on-MOVE-events-for-devices-w.patch 1072-udev-netif_rename-don-t-log-to-kmsg.patch 1073-udev-drop-print_kmsg.patch 1074-udev-fix-copy-paste-error-in-log-message.patch 1075-udev-timeout-increase-timeout.patch (bnc#889297) 1076-udev-timeout-warn-after-a-third-of-the-timeout-befor.patch (bnc#889297) 1077-udev-timeout-warn-after-a-third-of-the-timeout-befor.patch (bnc#889297)- udev: remove userspace firmware loading support (bnc#889297). Add 1068-udev-remove-userspace-firmware-loading-support.patch- udev: always resolve correctly database names on 'change' event (bnc#864745). Add 1067-udev-always-resolve-correctly-database-names-on-chan.patch- Add upstream patch 0009-hwdb-update.patch- Add upstream patches 0001-initrd-parse-etc.service-ignore-return-code-of-daemo.patch 0008-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Disable patch module-load-handle-SUSE-etc-sysconfig-kernel-module-list.patch for SLES-12 as well as for openSUSE-13.2 (bnc#895087)- udev: add option to generate old 'buggy' serials (bnc#886852) Add 1066-udev-add-compatibility-links-for-truncated-by-id-links.patch- Add upstream patch 0001-login-simplify-controller-handling.patch- Add upstream patches 0001-completion-filter-templates-from-restartable-units.patch 0002-systemd-fix-error-message.patch 0003-Quote-unit-names-in-suggested-systemctl-commandlines.patch 0004-config-parser-fix-mem-leak.patch 0005-login-fix-mem-leak.patch 1065-udev-bump-event-timeout-to-60-seconds.patch- Add upstream patch 0001-nspawn-fix-network-interface.patch to make option network-interface of systemd-nspawn work- Add upstream patches 0001-login-fix-memory-leak-on-DropController.patch 0002-util-fix-minimal-race-where-we-might-miss-SIGTERMs-w.patch 0003-sd-journal-properly-convert-object-size-on-big-endia.patch 0004-sd-journal-verify-that-object-start-with-the-field-n.patch - Add upstream patch 1064-udev-hwdb-do-not-look-at-usb_device-parents.patch to avoid that hwdb ID's for unrecognised USB device are taken from the USB hub.- Add upstream patches 0001-systemctl-Correct-error-message-printed-when-bus_pro.patch 0002-units-order-systemd-fsck-.service-after-local-fs-pre.patch 0003-keymap-Adjust-for-more-Samsung-900X4-series.patch- Add patch use-rndaddentropy-ioctl-to-load-random-seed.patch to use RNDADDENTROPY ioctl to load random-seed and to increase entropy count as well (bnc#892096)- Add upstream patches for hwdb 0001-hwdb-keymaps-for-Samsung-900X3E-900X3F.patch 0002-Add-hwdb-entry-for-Samsung-Series-7-Ultra.patch 0003-keymap-Fix-HP-Pavillon-DV7.patch 0004-hwdb-update-format-description-and-document-reloadin.patch 0008-hwdb-update.patch- Port back and add the missed upstream patches from 2014/08/22 0004-login-set_controller-should-fail-if-prepare_vt-fails.patch 0006-login-share-VT-signal-handler-between-sessions.patch- Add upstream patches 0001-nspawn-fix-truncation-of-machine-names-in-interface-.patch 0002-switch-root-umount-the-old-root-correctly.patch 0003-bootchart-it-s-not-OK-to-return-1-from-a-main-progra.patch 0005-sd-resolve-fix-allocation-if-query-ids-never-reuse-t.patch 0007-journald-also-increase-the-SendBuffer-of-dev-log-to-.patch 0008-mount-setup-fix-counting-of-early-mounts-without-SMA.patch 0009-journald-Fix-off-by-one-error-in-Missed-X-kernel-mes.patch 0010-machine_kill-Don-t-kill-the-unit-when-killing-the-le.patch 0011-units-fix-BindsTo-logic-when-applied-relative-to-ser.patch 0012-util-try-to-be-a-bit-more-NFS-compatible-when-checki.patch 1063-udev-path_id-suppress-ID_PATH-for-devices-with-an-un.patch- man pages from section 3 are developer docs, move them to the -devel package.- Add patch 0001-let-systemctl-completion-ignore-at-names.patch to remove error messages for tab completion for systemctl isolate (bnc#892162)- Disable the usage of the systemd groups wheel and adm (bnc#892300)- Set default permissions for GenWQE device nodes to 0666 (bnc#890977). Add 1062-rules-set-default-permissions-for-GenWQE-devices.patch- Add upstream patches 0007-hwdb-update.patch 1061-rules-allow-systemd-to-manage-loop-device-partitions.patch- Rename: udev-use-device-mapper-target-name-for-btrfs-device-ready.patch to 1060-udev-use-device-mapper-target-name-for-btrfs-device-ready.patch- udev: use device mapper target name for btrfs device ready (bnc#888215). - Add udev-use-device-mapper-target-name-for-btrfs-device-ready.patch- Add patch tomcat6-var-lock-subsys-legacy.patch to add the compatibility directory /var/lock/subsys (bnc#889357)- Add portabiltiy patch 1055-let-9719859c07aa13539ed2cd4b31972cd30f678543-apply.patch- Port and add upstream patch 0001-sysv-order-initscripts-which-provide-network-before-.patch 0002-keymap-Add-microphone-mute-keymap-for-Dell-Latitude.patch 0003-keymap-Annotate-all-micmute-workarounds.patch- Add patch tty-ask-password-agent-on-console.patch that is for system console do ask passphrases on all devices of the console (bnc#886211)- Add former SUSE and/now upstream patches (bnc#889297) 1056-udevd-add-event-timeout-commandline-option.patch 1057-udev-unify-event-timeout-handling.patch 1058-udev-unify-event-timeout-handling.patch (backport for compatibility if patch 1022 is not applied) 1059-udev-fixup-commit-dd5eddd28a74a49607a8fffcaf960040db.patch- Add patch shut-up-rpmlint-on-var-log-journal.patch to avoid rpmlink warning - Add upstream patches 0001-bus-proxyd-fix-incorrect-comparison.patch 0002-shell-completion-prevent-mangling-unit-names.patch 0003-Always-check-asprintf-return-code.patch 0004-bash-completion-use-list-unit-files-to-get-all-units.patch 0005-core-only-set-the-kernel-s-timezone-when-the-RTC-run.patch 0006-parse_boolean-require-exact-matches.patch 0007-drop_duplicates-copy-full-BindMount-struct.patch 0008-shell-completion-prevent-mangling-unit-names-bash.patch 0009-journald-always-add-syslog-facility-for-messages-com.patch- Disable blkrrpart for SLES12 and below- Add upstream patch 1054-udev-exclude-MD-from-block-device-ownership-event-lo.patch - Add with condition blkrrpart to be able to disable the patches 1025, 1027, 1029, 1030, 1031, 1032, 1033, 1034, 1037, and 1054 which uses the BLKRRPART ioctl for e.g. synthesize change events which may interfere with other tools like parted.- Update handle-disable_caplock-and-compose_table-and-kbd_rate.patch, handle-numlock-value-in-etc-sysconfig-keyboard.patch: read /etc/vconsole.conf after /etc/sysconfig/(keyboard,console) otherwise empty value in /etc/sysconfig/keyboard might override /etc/vconsole.conf values. - Update : 0001-journal-compress-return-early-in-uncompress_startswi.patch 0002-util-don-t-consider-tabs-special-in-string_has_cc-an.patch 0002-vconsole-setup-run-setfont-before-loadkeys.patch 0003-core-never-consider-failure-when-reading-drop-ins-fa.patch 0003-fsck-consider-a-fsck-implementation-linked-to-bin-tr.patch apply-ACL-for-nvidia-device-nodes.patch keep-crypt-password-prompt.patch log-target-null-instead-kmsg.patch parse-crypttab-for-noauto-option.patch set-and-use-default-logconsole.patch: fix all warnings in code - Remove 0001-compress-fix-return-value.patch: not relevant to systemd v210 code.- Also change udev-generate-peristent-rule to udev-generate-persistent-rule in file list- Rename (fix typo in script name): udev-generate-peristent-rule.sh to udev-generate-persistent-rule.sh- Enable better checks in write_net_rules to skip adding duplicated entries in the generate rules (bnc#888178). Add 1053-better-checks-in-write_net_rules.patch- Change patch set-and-use-default-logconsole.patch to avoid to write security/authorization (private) messages to console- Add patch set-and-use-default-logconsole.patch to use and set the default logging console for both journald and kernel messages- Add upstream patches 0001-bash-completion-p-option-for-journalctl.patch 0002-journalctl-man-allow-only-between-terms.patch 0003-systemd-use-pager-for-test-and-help.patch- Use verify scripts and add permission files for systemd logger - Avoid useless warning about static systemd unit files - Make pam file a config file - Remove non-break-space from this changelog- Add upstream patches 0001-compress-fix-return-value.patch 0002-Be-more-verbose-when-bind-or-listen-fails.patch 0003-Add-quotes-to-warning-message.patch 0004-systemd-return-the-first-error-from-manager_startup.patch- Replace patch 0001-fix-only-discover-Xen-domU.patch with upstream patch 0001-detect-virt-Fix-Xen-domU-discovery.patch - Replace patch 0001-detect-s390-virt.patch with upstream patch 0001-systemd-detect-virt-detect-s390-virtualization.patch- Add upstream patches 0001-po-add-Ukrainian-translation.patch 0002-man-document-yearly-and-annually-in-systemd.time-7.patch 0003-core-nicer-message-when-inotify-watches-are-exhauste.patch - Add patch 0001-fix-only-discover-Xen-domU.patch to fix upstream patch 0004-systemd-detect-virt-only-discover-Xen-domU.patch- Check if NAME key has a value before going thru the rule (bnc#885232). Add 1051-check-if-NAME-has-a-value.patch- Add upstream patches 0001-Clear-up-confusion-wrt.-ENTRY_SIZE_MAX-and-DATA_SIZE.patch 0002-units-serial-getty-.service-use-the-default-RestartS.patch 1052-rules-uaccess-add-ID_SOFTWARE_RADIO.patch- Only rename SRIOV-VF devices if device name start with eth (bnc#885232). Add 1050-only-rename-SRIOV-VF-devices-when-name-starts-with-eth.patch- Add patch vhangup-on-all-consoles.patch that is do a vhangup on lines (bnc#886599)- Removed %{_libexecdir}/modules-load.d/efivars.conf because the kernel patch of autoload efivars driver accepted by linux-efi upstream. (bnc#881559) https://git.kernel.org/cgit/linux/kernel/git/mfleming/efi.git/commit/?h=next&id=be756a5327fe3d4686d74d3e9b273010424e230c- Update patch 1007-physical-hotplug-cpu-and-memory.patch (bnc#869603) - Add script systemd-remount-tmpfs (bnc#869603) as helper script for the rule changed in patch 1007-physical-hotplug-cpu-and-memory.patch- Add upstream patch 0001-event-pull-in-sd-event.h-from-event-util.h.patch 0002-util-fix-has-cc-check-and-add-test.patch 0003-sd-event-always-call-epoll_ctl-on-mask-updates-if-ed.patch 0004-fileio-quote-more-shell-characters-in-envfiles.patch- Only on SLES12 seccomp is available on ppc64 and s390x- Port and add upstream patch 0001-units-make-ExecStopPost-action-part-of-ExecStart.patch- Add patches 0001-logind-allow-switching-to-unused-VTs-via-SwitchTo.patch 0002-hostnamed-add-a-new-chassis-type-for-watches.patch - Port and add upstream patches 0001-journal-compress-return-early-in-uncompress_startswi.patch 0002-journal-compress-improve-xz-compression-performance.patch- enable seccomp also for ppc64 and s390x- Port and add upstream patches 0001-util-consider-0x7F-a-control-chracter-which-it-is-DE.patch 0002-util-don-t-consider-tabs-special-in-string_has_cc-an.patch 0003-architecture-add-string-table-entries-for-mips-le-ar.patch 0004-core-Added-support-for-ERRNO-NOTIFY_SOCKET-message-p.patch 0005-service-don-t-accept-negative-ERRNO-notification-mes.patch 0006-systemctl-show-StatusErrno-value-in-systemctl-status.patch 0007-service-flush-status-text-and-errno-values-each-time.patch- Add upstream patch 1049-udev-link_config-ignore-errors-due-to-missing-MAC-ad.patch- Add upstream patch 0001-machine-don-t-return-uninitialized-variable.patch - Port and add upstream patch 0002-vconsole-setup-run-setfont-before-loadkeys.patch- Rename 0001-udev-net_setup_link-add-a-bit-more-logging.patch to 1048-udev-net_setup_link-add-a-bit-more-logging.patch- Port and add upstream patches 0001-udev-net_setup_link-add-a-bit-more-logging.patch 0003-namespace-make-sure-tmp-var-tmp-and-dev-are-writable.patch 0002-namespace-fix-uninitialized-memory-access.patch- Add upstream patches 0001-architecture-Add-tilegx.patch 0002-architecture-Add-cris.patch 0003-arch-add-crisv32-to-uname-check.patch 0004-architecture-remove-cris-from-uname-list.patch- Add upstream patches 0006-hwdb-update.patch 0007-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Add upstream patches 0001-parse_uid-return-ENXIO-for-1-uids.patch 0002-util-when-unescaping-strings-don-t-allow-smuggling-i.patch 0003-localed-consider-an-unset-model-as-a-wildcard.patch 0004-sd-bus-when-an-event-loop-terminates-explicitly-clos.patch 0005-bus-close-a-bus-that-failed-to-connect.patch 1047-udev-net_setup_link-builtin-should-print-the-reason-.patch- Fix duplicated rules when having layer3 interfaces (bnc#882714). Add 1046-fix-duplicated-rules-with-layer3-interfaces.patch- Require correct pam-config version overall even for scriptlets (bnc#885288)- Add upstream patches 0001-main-uid_to_name-might-fail-due-to-OOM-protect-again.patch 0002-journald-make-MaxFileSec-really-default-to-1month.patch 0003-units-remove-RefuseManualStart-from-units-which-are-.patch 0004-util-refuse-considering-UID-0xFFFF-and-0xFFFFFFFF-va.patch 0005-nspawn-block-open_by_handle_at-and-others-via-seccom.patch 0006-tmpfiles-don-t-do-automatic-cleanup-in-XDG_RUNTIME_D.patch 0007-units-skip-mounting-tmp-if-it-is-a-symlink.patch- Be aware that close_nointr_nofail() may fail whereas safe_close() not- Add upstream patches 1042-libudev-queue-provide-file-descriptor-to-watch-busy-.patch 1043-libudev-queue-watch-entire-directory-to-allow-the-re.patch 1044-rules-update-qemu-hid-rules.patch 1045-rules-don-t-enable-usb-pm-for-Avocent-devices.patch- Add upstream bug fix patch 1041-libudev-fix-udev_queue_get_queue_is_empty-logic.patch (bnc#882714)- Update of patch 0001-detect-s390-virt.patch (bnc#880438)- Shut up stupid check scripts crying for not mentioned systemd-mini-rpmlintrc- Add upstream patchs 0001-core-use-correct-format-string-for-UIDs.patch 0002-core-transaction-fix-cycle-break-attempts-outside-tr.patch 0003-fsck-consider-a-fsck-implementation-linked-to-bin-tr.patch- Add upstream patch 0001-units-order-network-online.target-after-network.targ.patch to make sure that etwork-online.target follows network.target- rules: re-enable dev_id conditionally in persistent rules (bnc#884403 and bnc#882714). Add 1040-re-enable-dev_id-conditionally-in-persistent-rules.patch- Add upstream patches 0001-vconsole-also-copy-character-maps-not-just-fonts-fro.patch 0002-core-make-sure-Environment-fields-passed-in-for-tran.patch 0003-core-You-can-not-put-the-cached-result-of-use_smack-.patch 0004-cryptsetup-don-t-add-unit-dependency-on-dev-null-dev.patch 0005-man-fix-path-in-crypttab-5.patch- Add upstream patch 1039-udevadm-settle-fixed-return-code-for-empty-queue.patch it fixes udevadm settle exit code which may had broken dracut scripts (bnc#884271 comment#18)- Temporary disable patch 1022 (bnc#884271 and bnc#882714).- Rename 0002-udev-fix-invalid-free-in-enable_name_policy.patch to 1038-udev-fix-invalid-free-in-enable_name_policy.patch- Replace patches 0001-systemd-empty-sigmask-on-reexec.patch with upstream 0008-Reset-signal-mask-on-re-exec-to-init.patch ensure-sysctl-are-applied-after-modules-are-loaded.patch with upstream 0001-units-systemd-sysctl.service.in-run-after-load-modul.patch getty-generator-with-serial-3270-tty.patch with upstream 0004-getty-generator-properly-escape-instance-names.patch - Add upstream patches 0002-units-add-missing-caps-so-that-GetAddresses-can-work.patch 0003-units-order-systemd-tmpfiles-clean.service-after-tim.patch 0005-po-add-Greek-translation.patch 0006-hwdb-Update-database-of-Bluetooth-company-identifier.patch 0007-po-add-German-translation.patch 0009-core-clean-up-signal-reset-logic-when-reexec.patch 0010-util-treat-fuse.sshfs-as-a-network-filesystem.patch 0011-build-sys-add-pthread-flag-for-libsystemd-shared.patch 0012-core-transaction-avoid-misleading-error-message-when.patch- Invert of the boolean for locking scheme of fsck (bnc#881125) - Remove the ghost entry /etc/hostname and require the netcfg- make sure legacy services that depend on network are started after network is available (bnc#883565) * 0001-core-sysvcompat-network-should-be-equivalent-to-netw.patch * update insserv-generator.patch to translate $network into network-online.target- Add patch 0001-detect-s390-virt.patch from Thomas Blume (bnc#880438) to detect the virtualization layers on s390x as well- Do not generate synthesize change for cd/dvd (bnc#882714, comment #51) add patch 1037-udev-exclude-cd-dvd-from-block-device.patch from Roberts suggestion as well as readd 1022-udev-remove-seqnum-API-and-all-assumptions-about-seq.patch- Add upstream patches 0001-core-fix-invalid-free-in-killall.patch 0002-udev-fix-invalid-free-in-enable_name_policy.patch 0003-install-fix-invalid-free-in-unit_file_mask.patch- rules: disable usage of dev_id in persistent rules (bnc#882714). add: 1036-rules-disable-usage-of-dev_id-in-persistent-rules.patch - Disable patch (bnc#882714). 1022-udev-remove-seqnum-API-and-all-assumptions-about-seq.patch- Add patch 1035-99-systemd.rules-Ignore-devices-with-SYSTEMD_READY-0.patch from Hannes Reinecke to avoid a race condition between variable 'SYSTEMD_READY=0' and 'systemd' tag within udev rules (bnc#881942)- Add workaround for bnc#882393 by adding the systemd update utmp runlevel service to the wanted unit of e.g. the graphical target - Add some later on created files to our file list- Generate %{_libexecdir}/modules-load.d/efivars.conf so we load efivars module at boot time not from udev (bnc#881559).- Do not build EFI support code in architectures on which the kernel does not support CONFIG_EFI, it won't work. (ia64 also supports it, but that's dead so is not included)- Add patch tmpfiles-do-not-clean-for-mandb-index-files.patch there is no need to clean out all 30 days the index data base files nor the cachedir tags of mandb. Those files are used for whatis(1) as well as for apropos(1).- Do not override predictable names for openSUSE- Remove systemd-detect-xendom.patch as it becomes obsolete with upstream patch 0004-systemd-detect-virt-only-discover-Xen-domU.patch - Add upstream patches 0001-umount-modernizations.patch 0002-namespace-when-setting-up-an-inaccessible-mount-poin.patch 0003-core-allow-transient-mount-units.patch 0004-systemd-detect-virt-only-discover-Xen-domU.patch 0005-backlight-Do-not-clamp-brightness-for-LEDs.patch 0006-log-honour-the-kernel-s-quiet-cmdline-argument.patch- Add upstream patches 1033-udev-really-exclude-device-mapper-from-block-device.patch 1034-udev-check-the-return-value-from-udev_enumerate_scan.patch- Change detection of new locking scheme of fsck- Change 1021-udev-re-add-persistent-net-rules.patch to use persistent rules as a default on SLES-12 and predictable rules as a default otherwise - Add cflags shell function to check possible flags for the compiler as well as for the linker- Add upstream patches 1025-udev-exclude-device-mapper-from-block-device-ownersh.patch 1026-udevd-inotify-modernizations.patch 1027-udev-synthesize-change-events-for-partitions-when-to.patch 1028-udev-link-config-fix-mem-leak.patch 1029-udev-try-first-re-reading-the-partition-table.patch 1030-udev-guard-REREADP-logic-with-open-O_ECXL.patch 1031-udev-make-sure-we-always-get-change-for-the-disk.patch 1032-udev-guard-REREADPT-by-exclusive-lock-instead-of-O_E.patch- Add upstream patches 0001-sd-event-restore-correct-timeout-behaviour.patch 0002-bus-make-use-of-sd_bus_try_close-in-exit-on-idle-ser.patch- Add upstream patch 0001-hwdb-fix-case-sensitive-match.patch- Add dynamic detection of util-linux version to be able to disable the fsck option -l for version less than 2.25.0- Add changes from Cristian Rodríguez: * The patches delay-fsck-cryptsetup-after-md-dmraid-lvm-are-started.patch and ensure-DM-and-LVM-are-started-before-local-fs-pre-target.patch indeed mention unit files which do not exist anymore. - Make sure that systemd-ask-password-wall.service has a tty as it is not sure that a tty1 exists - Avoid broken firmware loading on newer distributions as 13.1- Correct version check for the tcp-devel drop - Use correct permissions for /var/log/journal - Use ACLs for /var/log/journal as described in man:systemd-journald.service(8)- Correct the libseccomp distribution version test must be >= 13.1 - In order to use unit directive AppArmorProfile= libapparmor-devel must be present in buildRequires.- apply-ACL-for-nvidia-uvm-device-node.patch: set ACL on nvidia-uvm device (bnc#879767).- Add changes from Cristian Rodríguez: * fix keep-crypt-password-prompt.patch which floods the system logs with bogus opendir failures, still the wrong thing to do however. * Use %find_lang to collect locale files * systemd-no-libattr.patch: systemd does not require libattr but just sys/xattr.h, therefore drop the dependency. (from upstream) * Again, drop tcp-devel from buildRequires, this time it is not a SUSE specific feature removal, tcpd supportdisappeared in systemd 212 and we shouldn't keep it around. - Add patch 0001-build-sys-use-glibc-s-xattr-support-instead-of-requi.patch that is rename systemd-no-libattr.patch to git format - Drop tcp-devel only for *next* openSUSE and not for SLES-12 nor for openSUSE 13.1- Add upstream patches 0001-virt-rework-container-detection-logic.patch 0002-fsck-include-device-name-in-the-message-about-missin.patch 0003-units-use-KillMode-mixed-for-systemd-nspawn-.service.patch 0004-util-ignore_file-should-not-allow-files-ending-with.patch 0006-tty-ask-password-agent-Do-tell-what-directory-we-fai.patch - Add upstream patches to update keyboard data base 0007-keyboard-add-Plantronics-.Audio-mute-button.patch - Add upstream patches for udev 1023-udev-builtin-keyboard-do-tell-on-which-device-EVIOCS.patch 1024-udev-always-close-lock-file-descriptor.patch- Fix enabling predictable rules when using net.ifnames=1. update: 1021-udev-re-add-persistent-net-rules.patch- Re-add persistent rules as a default and make predictable rules as fallback (bnc#880732). add: 1021-udev-re-add-persistent-net-rules.patch - udev: remove seqnum API and all assumptions about seqnums add: 1022-udev-remove-seqnum-API-and-all-assumptions-about-seq.patch- Add upstream patches 0001-Do-not-unescape-unit-names-in-Install-section.patch 0002-analyze-run-use-bus_open_transport_systemd-instead-o.patch- Add upstream patch 1020-udev-keyboard-also-hook-into-change-events.patch- Add upstream patches to update keyboard data base 0001-keymap-Add-Lenovo-Enhanced-USB-Keyboard.patch 0002-keymap-Asus-EeePC-touchpad-toggle-key.patch - Add upstream patches 0001-nspawn-allow-to-bind-mount-journal-on-top-of-a-non-e.patch 0002-nspawn-restore-journal-directory-is-empty-check.patch 0003-core-never-consider-failure-when-reading-drop-ins-fa.patch 0004-socket-properly-handle-if-our-service-vanished-durin.patch- fix file list of systemd.pc- Add a workaround for old distributions like 13.1 to avoid deadlocks due NFS shares stopped after network- Add upstream patches 0001-journal-cleanup-up-error-handling-in-update_catalog.patch 0002-journal-properly-detect-language-specified-in-line.patch 0003-man-mention-XDG_CONFIG_HOME-in-systemd.unit.patch- Add upstream patches to update usb and pci company identifiers 0001-hwdb-update.patch 0002-hwdb-update.patch 0003-hwdb-PCI-include-primary-model-string-in-subsystem-m.patch 0004-hwdb-update.patch 0005-hwdb-update.patch- Move systemd.pc and udev.pc to their main packages (bnc#876587)- Add upstream patches 0001-conf-parser-silently-ignore-sections-starting-with-X.patch 0002-man-note-that-entire-sections-can-now-be-ignored.patch 0004-machined-make-sure-GetMachineAddresses-is-available-.patch 0005-core-Filter-by-state-behind-the-D-Bus-API-not-in-the.patch 0006-login-add-mir-to-the-list-of-session-types.patch 0007-logind-fix-Display-property-of-user-objects.patch- Add upstream patches to update BluTooth company identifiers 0001-hwdb-Update-database-of-Bluetooth-company-identifier.patch 0002-hwdb-Update-database-of-Bluetooth-company-identifier.patch 0003-hwdb-Update-database-of-Bluetooth-company-identifier.patch 0004-hwdb-Update-database-of-Bluetooth-company-identifier.patch 0005-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Add upstream patches to allow processes to serialize block device events, also do execute the RUN tag if rename of a network device fails: 1016-udev-serialize-synchronize-block-device-event-handli.patch 1017-udev-do-not-skip-the-execution-of-RUN-when-renaming-.patch 1018-udev-avoid-use-of-uninitialized-err.patch - Rename 0002-udev-warn-when-name_to_handle_at-is-not-implemented.patch to 1016-udev-warn-when-name_to_handle_at-is-not-implemented.patch- Add upstream patches mainly for better lid handling (bnc#878525 and bnc#868019) 0001-logind-ignore-lid-switch-if-more-than-1-display-is-c.patch 0002-logind-fix-printf-format.patch 0003-logind-ignore-lid-switch-events-for-30s-after-each-s.patch 0004-logind-Do-not-fail-display-count-if-a-device-has-no-.patch 0005-logind-move-lid-switch-handling-from-logind-main-to-.patch 0006-man-clarify-that-the-ExecReload-command-should-be-sy.patch 0007-man-readahead-fix-cmdline-switch-inconsistency-betwe.patch 0008-man-update-journald-rate-limit-defaults.patch 0009-nspawn-properly-format-container_uuid-in-UUID-format.patch 0010-logind-allow-suspending-if-there-are-no-displays.patch- Make baselibs.conf aware to use the appropiate %post and %postun scriptlets which includes pam-config (bnc#877674)- Add upstream patches 0001-core-close-socket-fds-asynchronously.patch 0002-logind-bring-polkit-policy-for-hibernate-in-line-wit.patch 0003-core-make-sure-to-serialize-jobs-for-all-units.patch- Add upstream patches 0001-replace-more-dup-by-F_DUPFD_CLOEXEC.patch 0002-pam_systemd-use-F_DUPFD_CLOEXEC-when-dupping-session.patch to avoid that in pam session unwanted file descriptors are inherited- Add patch log-target-null-instead-kmsg.patch from Thomas Blume to enable the kernel developers to see a clean kmsg ring buffer without any systemd/udev messages included (bnc#877021)- Add upstream patches for backlight 0001-backlight-Avoid-restoring-brightness-to-an-unreadabl.patch 0002-backlight-do-nothing-if-max_brightness-is-0.patch 0003-backlight-unify-error-messages.patch 0004-backlight-warn-if-kernel-exposes-backlight-device-wi.patch 0005-backlight-handle-saved-brightness-exceeding-max-brig.patch- Add upstream patches 0001-errno-make-sure-to-handle-the-3-errnos-that-are-alia.patch 0002-udev-warn-when-name_to_handle_at-is-not-implemented.patch 0003-analyze-fix-plot-with-bad-y-size.patch 0004-job-add-waiting-jobs-to-run-queue-in-unit_coldplug.patch 0005-job-always-add-waiting-jobs-to-run-queue-during-cold.patch- Drop upstream-net_id-changes.patch and replace them with the correct patches from upstream and their commits: add: 1014-udev-update-net_id-comments.patch add: 1015-udev-persistent-naming-we-cannot-use-virtio-numbers-.patch- Add patch parse-crypttab-for-noauto-option.patch from Thomas Blume to handle the option 'noauto' in /etc/crypttab (bnc#742774)- Modify and extend patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch to have the correct terminal type used with agetty - Add patch 0001-tmpfiles-fix-permissions-on-new-journal-files.patch to allow users to access systemd user journal (bnc#876694)- Port upstream patch 0001-sd-rtnl-message-append-fix-uninitialized-memory.patch back to 210 - Add patch keep-crypt-password-prompt.patch from Thomas Blume to fix bnc#875502 - fails to boot when swap space is encrypted - Port upstream patch set for net_id back in patch upstream-net_id-changes.patch- Add patch shut-up-annoying-assertion-monotonic-clock-message.patch to avoid annyoing messages on failing dual_timestamp_is_set in the kernel's message ring buffer- Update udev-generate-peristent-rule.sh from latest git- Modify and extend patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch to avoid also ANSI escape sequences for busy jobs on s390- Add or port upstream bugfix patches: 0001-bash-completion-fix-__get_startable_units.patch 0002-sysctl-replaces-some-slashes-with-dots.patch 0003-delta-do-not-use-unicode-chars-in-C-locale.patch 0004-implement-a-union-to-pad-out-file_handle.patch - Add patch respect-nfs-bg-option.patch from Thomas Blume: System fails to boot if nfs mounts get added to fstab (bnc#874665)- Do not use runtime PM for some IBM consoles (bnc#868931) 1013-no-runtime-PM-for-IBM-consoles.patch- Extend avoid-divide-by-zero-sigtrap.patch to make the crash handler know about SIGTRAP and SIGSYS- Add avoid-divide-by-zero-sigtrap.patch which fixes bnc#867663 that is a divide by zero on a jobless system- Use latest regenerate-initrd rpm macros (fate#313506) - Add rescue-emergency-target-conflicts.patch to avoid that emergency and rescue sulogin are fighting on console- Modify systemd-sleep-grub to let hybrid-sleep.target work even on XEN, changes from Thomas Blume (bnc#873432)- Add backported upstream patch 0001-reduce-the-amount-of-messages-logged-to-dev-kmsg-whe.patch - Add patch systemd-detect-xendom.patch from Thomas Blume to be able to detect XEN dom0 as well as domU - systemd conflicts with sysvinit, ven if the package systemd-sysvinit does already conflict with sysvinit-init (bnc#873444)- Add two patches from hare@suse.com 1011-64-btrfs.rules-skip-btrfs-check-if-devices-are-not-r.patch 1012-Skip-persistent-device-link-creation-on-multipath-de.patch to solve bnc#872929- Increase result size for programs stdout (bnc#867840). add: 1010-udev-increase-result-size-for-programs.patch - Update udev-generate-peristent-rule.sh to the latest version. - Clean-up spec file, re-arange patch to suit the setup, all udev patches start with 1XXX-*.{patch,diff}. - Rename: 0013-cdrom_id-use-the-old-MMC-fallback.patch to 1009-cdrom_id-use-the-old-MMC-fallback.patch - Rename: 1009-make-xsltproc-use-correct-ROFF-links.patch to 0009-make-xsltproc-use-correct-ROFF-links.patch - Rename: 1010-do-not-install-sulogin-unit-with-poweroff.patch to 0010-do-not-install-sulogin-unit-with-poweroff.patch - Rename: 1014-journald-with-journaling-FS.patch to 0014-journald-with-journaling-FS.patch - Rename: 1018-Make-LSB-Skripts-know-about-Required-and-Should.patch to 0018-Make-LSB-Skripts-know-about-Required-and-Should.patch - Rename: 1019-make-completion-smart-to-be-able-to-redirect.patch to 0019-make-completion-smart-to-be-able-to-redirect.patch - Rename: 1022-systemd-tmpfiles-ownerkeep.patch to 0022-systemd-tmpfiles-ownerkeep.patch- Add patch portmap-wants-rpcbind-socket.patch to make sure that rpcbind socket as well as service is up with the target - Add or port upstream bugfix patches: 0001-journal-fix-export-of-messages-containing-newlines.patch 0002-systemctl-update-NAME-to-PATTERN-in-help.patch 0003-tty-ask-password-agent-return-negative-errno.patch 0004-systemd-python-use-.hex-instead-of-.get_hex.patch 0005-systemd-python-fix-failing-assert.patch- Add or port upstream bugfix patches: 0001-cgroup-it-s-not-OK-to-invoke-alloca-in-loops.patch 0002-machined-fix-Kill-bus-call-on-machine-objects-when-w.patch 0003-sd-bus-don-t-use-assert_return-to-check-for-disconne.patch 0004-core-don-t-try-to-relabel-mounts-before-we-loaded-th.patch 0005-sd-daemon-fix-incorrect-variable-access.patch 0006-sd-event-initialization-perturbation-value-right-bef.patch 0007-sd-event-don-t-accidentally-turn-of-watchdog-timer-e.patch 0008-systemctl-kill-mode-is-long-long-gone-don-t-mention-.patch 0009-ask-password-when-the-user-types-a-overly-long-passw.patch - Modify patch 1019-make-completion-smart-to-be-able-to-redirect.patch to work together with 0008-systemctl-kill-mode-is-long-long-gone-don-t-mention-.patch- Use Robert's revised 1006-udev-always-rename-network.patch- Readd patch Forward-suspend-hibernate-calls-to-pm-utils.patch older code base as 13.1 only - Add patch avoid-random-hangs-on-timeouts-due-lost-cwd.patch to be able to terminate the user manager even if cwd of the user is gone- add prepare-suspend-to-disk.patch enable suspend conditions check and preparation for systemd-sleep (fate#316824, bnc#856389, bnc#856392) - remove Forward-suspend-hibernate-calls-to-pm-utils.patch since it is obsolete (bnc#856392#c20) - add boot-local-start.patch fix startup for /etc/init.d/boot.local (bnc#869142)- also autoreconf in systemd-mini to simplify spec file logic and fix build in staging:gcc49 (obsoleting 0002-make-209-working-on-older-dist.patch)- Be sure that the refreshed manual pages are installed- Add patch systemctl-set-default-target.patch which explain how to override the default.target by using --force (bnc#868439)- Add Robert's udev-generate-peristent-rule shell script to udev's tool library - Add or port upstream bugfix patches: 0001-gpt-auto-generator-don-t-return-OOM-on-parentless-de.patch 0002-bus-fix-memory-leak-when-kdbus-is-not-enabled.patch 0006-Do-not-return-1-EINVAL-on-allocation-error.patch 0007-networkd-fix-typo.patch 0008-sd-bus-don-t-access-invalid-memory-if-a-signal-match.patch 0009-sd-bus-don-t-choke-if-somebody-sends-us-a-message-wi.patch 0012-journald-remove-stray-reset-of-error-return-value.patch 0013-core-libsystemd-systemd-timedate-udev-spelling-fixes.patch- Add patch getty-generator-with-serial-3270-tty.patch to avoid harmless error messages on not existing getty@3270 files- Replace systemd-big-endian-reply-matching.patch with upstream 0001-sd-bus-don-t-look-for-a-64bit-value-when-we-only-hav.patch to solve broken systemd communication with and over dbus (bnc#866732)- Readd patch 1008-add-msft-compability-rules.patch for older code base as 13.1 - Modify pre_checkin.sh to throw an error if a patch will be applied which modifies one of Makefile.am, Makefile.in, or configiure.ac as this breaks bootstrapping - Add second version of make-209-working-on-older-dist.patch to be able to apply for bootstrapping version- Don't require non-existing binutils-gold- Avoid file conflict between udev and systemd (bnc#868230)- Modify patch module-load-handle-SUSE-etc-sysconfig-kernel-module-list.patch to ignore if /etc/sysconfig/kernel does not exist (bnc#865834)- Add patch systemd-big-endian-reply-matching.patch make sure that systemd can talk with dbus-daemon even on big endian systems (bnc#866732)- Due to previous reason, resurrect systemd-dbus-system-bus-address.patch - Removed pkgconfig(dbus-1) BuildRequires - with 209 and newer, itis only needed for quering default DBus directories, which we nowpass to configure. This also unbreaks libdbus <-> systemd-miniBuild Cycle- Add or port upstream bugfix patches: 0001-core-busname-add-lookup-string-for-BUSNAME_FAILURE_S.patch 0002-manager-flush-memory-stream-before-using-the-buffer.patch 0003-busname-don-t-drop-service-from-the-result-string.patch 0004-fix-off-by-one-error-in-array-index-assertion.patch 0005-logind-fix-policykit-checks.patch 0006-rules-mark-loop-device-as-SYSTEMD_READY-0-if-no-file.patch 0007-dbus-suppress-duplicate-and-misleading-messages.patch 0008-man-multiple-sleep-modes-are-to-be-separated-by-whit.patch- Make compeletion file parser work (bnc#867664)- Integrate powerd handling in initctl service + Remove 1016-support-powerfail-with-powerstatus.patch + Remove systemd-powerfail + Add systemd-powerd-initctl-support.patch - Remove 61-msft.rules; superseded by sg3_utils (bnc#866933) - Persistent by-path links for ATA devices (FATE#317063) + Update 1001-re-enable-by_path-links-for-ata-devices.patch- Add or port upstream bugfix patches: 0001-Fix-systemd-stdio-bridge-symlink.patch 0002-execute-free-directory-path-if-we-fail-to-remove-it-.patch 0003-Do-not-print-invalid-UTF-8-in-error-messages.patch 0004-man-document-missing-options-of-systemd-run.patch 0005-systemd-run-add-some-extra-safety-checks.patch 0006-journal-assume-that-next-entry-is-after-previous-ent.patch 0007-journal-forget-file-after-encountering-an-error.patch 0008-core-correctly-unregister-PIDs-from-PID-hashtables.patch 0009-logind-fix-reference-to-systemd-user-sessions.servic.patch 0010-man-update-link-to-LSB.patch 0011-man-systemd-bootchart-fix-spacing-in-command.patch 0012-man-add-missing-comma.patch 0013-units-Do-not-unescape-instance-name-in-systemd-backl.patch- Add linker scripts as place holder of the old systemd shared libraries now all included in libsystemd.so (bnc#867128)- Make patch 1006-udev-always-rename-network.patch work again and add it again.- address missing owner functionality in systemd-tmpfiles (fate#314974) 1022-systemd-tmpfiles-ownerkeep.patch- Generate the bash completion files on the fly for the case of not having the package bash-completion around - Add or port upstream bugfix patches: 0001-nspawn-fix-detection-of-missing-proc-self-loginuid.patch 0002-cdrom_id-use-the-old-MMC-fallback.patch 0003-journalctl-refuse-extra-arguments-with-verify-and-si.patch 0004-logs-show-fix-corrupt-output-with-empty-messages.patch 0005-mount-don-t-fire-PropertiesChanged-signals-for-mount.patch 0006-mount-don-t-send-out-PropertiesChanged-message-if-ac.patch 0007-Use-var-run-dbus-system_bus_socket-for-the-D-Bus-soc.patch 0008-README-document-that-var-run-must-be-a-symlink-run.patch 0010-Replace-var-run-with-run-in-remaining-places.patch 0009-Revert-back-to-var-run-at-a-couple-of-problems.patch 0011-fix-typo-in-iDRAC-network-interface-name-irdac-idrac.patch 0012-login-Allow-calling-org.freedesktop.login1.Seat.Swit.patch 0013-login-set-pos-slot-to-fallback-on-pos-eviction.patch 0014-login-fix-pos-array-allocation.patch- Update to Release v210 + systemd will now relabel /dev after loading the SMACK policy according to SMACK rules. + A new unit file option AppArmoreProfile= has been added to set the AppArmor profile for the processes of a unit. + A new condition check ConditionArchitecture= has been added to conditionalize units based on the system architecture, as reported by uname()'s "machine" field. + systemd-networkd now supports matching on the system virtualization, architecture, kernel command line, host name and machine ID. + logind is now a lot more aggressive when suspending the machine due to a closed laptop lid. + logind will now watch SW_DOCK switches and inhibit reaction to the lid switch if it is pressed. + nspawn will now make use of the devices cgroup controller by default, and only permit creation of and access to the usual API device nodes like /dev/null or /dev/random, as well as access to (but not creation of) the pty devices. + systemd will now understand the usual M, K, G, T suffixes according to SI conventions (i.e. to the base 1000) when referring to throughput and hardware metrics. + The DeviceAllow= setting in unit files now supports a syntax to whitelist an entire group of devices node majors at once, based on the /proc/devices listing. For example, with the string "char-pts" it is now possible to whitelist all current and future pseudo-TTYs at once. + sd-event learned a new "post" event source. Event sources of this type are triggered by the dispatching of any event source of a type that is not "post". This is useful for implementing clean-up and check event sources that are triggered by other work being done in the program. + The compatibility libraries for libsystemd-journal.so, libsystem-id128.so, libsystemd-login.so and libsystemd-daemon.so do not make use of IFUNC anymore. - Dropped systemd patches as those are fixed upstream: * 0001-units-serial-getty-.service-add-Install-section.patch * 0001-shared-architecture.h-fix-preprocessor-directives.patch * 0001-selinux-Don-t-attempt-to-load-policy-in-initramfs-if.patch * 0001-sd-event-Fix-systemd-crash-when-using-timer-units.patchc * 0001-make-tests-with-libseccomp-work.patch * 0001-build-sys-Fix-compilation-of-nspawn-when-seccomp-is-.patch * 0001-units-serial-getty-.service-add-Install-section.patch - Dropped patches as those do not work anymore * 1006-udev-always-rename-network.patch - Renamed systemd patches as seen from git log: * 0001-cdrom_id-use-the-old-MMC-fallback.patch become 0002-cdrom_id-use-the-old-MMC-fallback.patch * 0001-journalctl-refuse-extra-arguments-with-verify-and-si.patch become 0003-journalctl-refuse-extra-arguments-with-verify-and-si.patch * 0001-logs-show-fix-corrupt-output-with-empty-messages.patch become 0004-logs-show-fix-corrupt-output-with-empty-messages.patch - Add several upstream bugfix patches which are missed: * 0001-build-sys-Add-setns-functions-if-not-in-the-C-librar.patch * 0001-build-sys-Fix-compilation-of-nspawn-when-seccomp-is-.patch * 0001-sd-event-Fix-systemd-crash-when-using-timer-units.patch * 0001-selinux-Don-t-attempt-to-load-policy-in-initramfs-if.patch * 0001-shared-architecture.h-fix-preprocessor-directives.patch * 0005-mount-don-t-fire-PropertiesChanged-signals-for-mount.patch * 0006-mount-don-t-send-out-PropertiesChanged-message-if-ac.patch * 0007-Use-var-run-dbus-system_bus_socket-for-the-D-Bus-soc.patch * 0008-README-document-that-var-run-must-be-a-symlink-run.patch * 0009-Revert-back-to-var-run-at-a-couple-of-problems.patch * 0010-Replace-var-run-with-run-in-remaining-places.patch * 0011-fix-typo-in-iDRAC-network-interface-name-irdac-idrac.patch * 0012-login-Allow-calling-org.freedesktop.login1.Seat.Swit.patch * 0013-login-set-pos-slot-to-fallback-on-pos-eviction.patch * 0014-login-fix-pos-array-allocation.patch - Modified patches to make is build * 0001-add-network-device-after-NFS-mount-units.patch - Reenable libseccomp for the architecture for which libseccomp exists- always install compat pkgconfig files, regardless if compat libs is enabled or not- disable use of libseccomp for sle12, library has not been ported to most architectures - do not use binutils-gold on s390/s390x, does not exist there - fix exclude statements for bootstrap case- Add upstream patches + 0001-cdrom_id-use-the-old-MMC-fallback.patch + 0001-logs-show-fix-corrupt-output-with-empty-messages.patch + 0001-journalctl-refuse-extra-arguments-with-verify-and-si.patch- Add patch 0001-systemd-empty-sigmask-on-reexec.patch which corrects sigmaks for reexec in initrd (bnc#864904)- Add patch 0001-nspawn-fix-detection-of-missing-proc-self-loginuid.patch to avoid error on not existing file /proc/self/loginuid- Make patch 0001-make-209-working-on-older-dist.patch more smart that is make configure script les restrictive - Make patch apply-ACL-for-nvidia-device-nodes.patch apply to v209- Update to Release v209 on the base of the work of Stefan Brüns from declined submit request 223602: + A new tool "systemd-socket-proxyd" has been added + Add a new tool to save/restore rfkill state on shutdown/boot. + Save/restore state of keyboard backlights in addition to display backlights on shutdown/boot. + udev learned a new SECLABEL{} construct to label device nodes with a specific security label when they appear. For now, only SECLABEL{selinux} is supported, but the syntax is prepared for additional security frameworks. + When the User= switch is used in a unit file, also initialize $SHELL= based on the user database entry. + systemd no longer depends on libdbus. All communication is now done with sd-bus, systemd's low-level bus library implementation. + sd-bus: add a light-weight vtable implementation that allows defining objects on the bus with a simple static const vtable array of its methods, signals and properties. + systemd will not generate or install static dbus introspection data anymore to /usr/share/dbus-1/interfaces, as the precise format of these files is unclear, and nothing makes use of it. + A proxy daemon is now provided to proxy clients connecting via classic D-Bus AF_UNIX sockets to kdbus, to provide full compatibility with classic D-Bus. + A bus driver implementation has been added that supports the classic D-Bus bus driver calls on kdbus, also for compatibility purposes. + A new API "sd-event.h" has been added that implements a minimal event loop API built around epoll. + A new API "sd-rntl.h" has been added that provides an API around the route netlink interface of the kernel, similar in style to "sd-bus.h". + A new API "sd-dhcp-client.h" has been added that provides a small DHCPv4 client-side implementation. This is used by "systemd-networkd". + There is a new kernel command line option "systemd.restore_state=0|1". When set to "0", none of the systemd tools will restore saved runtime state to hardware devices. More specifically, the rfkill and backlight states are not restored. + The FsckPassNo= compatibility option in mount/service units has been removed. The fstab generator will now add the necessary dependencies automatically, and does not require PID1's support for that anymore. + journalctl gained a new switch, --list-boots, that lists recent boots with their times and boot IDs. + The various tools like systemctl, loginctl, timedatectl, busctl, systemd-run, ... have gained a new switch "-M" to connect to a specific, local OS container (as direct connection, without requiring SSH). + systemd-run and systemd-analyze also gained support for "-H" to connect to remote hosts via SSH. This is particularly useful for systemd-run because it enables queuing of jobs onto remote systems. + machinectl gained a new command "login" to open a getty login in any local container. This works with any container that is registered with machined (such as those created by libvirt-lxc or nspawn), and which runs systemd inside. + machinectl gained a new "reboot" command that may be used to trigger a reboot on a specific container that is registered with machined. This works on any container that runs an init system of some kind. + systemctl gained a new "list-timers" command to print a nice listing of installed timer units with the times they elapse next. + Alternative reboot() parameters may now be specified on the "systemctl reboot" command line and are passed to the reboot() system call. + systemctl gained a new --job-mode= switch to configure the mode to queue a job with. This is a more generic version of - -fail, --irreversible, and --ignore-dependencies, which are still available but not advertised anymore. + /etc/systemd/system.conf gained new settings to configure various default timeouts of units, as well as the default start limit interval and burst. These may still be overridden within each Unit. + PID1 will now export on the bus profile data of the security policy upload process (such as the SELinux policy upload to the kernel). + journald: when forwarding logs to the console, include timestamps (following the setting in /sys/module/printk/parameters/time). + OnCalendar= in timer units now understands the special strings "yearly" and "annually". (Both are equivalent) + The accuracy of timer units is now configurable with the new AccuracySec= setting. It defaults to 1min. + A new dependency type JoinsNamespaceOf= has been added that allows running two services within the same /tmp and network namespace, if PrivateNetwork= or PrivateTmp= are used. + A new command "cat" has been added to systemctl. It outputs the original unit file of a unit, and concatenates the contents of additional "drop-in" unit file snippets, so that the full configuration is shown. + systemctl now supports globbing on the various "list-xyz" commands, like "list-units" or "list-sockets", as well as on those commands which take multiple unit names. + journalctl's --unit= switch gained support for globbing. + All systemd daemons now make use of the watchdog logic so that systemd automatically notices when they hang. + If the $container_ttys environment variable is set, getty-generator will automatically spawn a getty for each listed tty. This is useful for container managers to request login gettys to be spawned on as many ttys as needed. + %h, %s, %U specifier support is not available anymore when used in unit files for PID 1. This is because NSS calls are not safe from PID 1. They stay available for --user instances of systemd, and as special case for the root user. + loginctl gained a new "--no-legend" switch to turn off output of the legend text. + The "sd-login.h" API gained three new calls: sd_session_is_remote(), sd_session_get_remote_user(), sd_session_get_remote_host() to query information about remote sessions. + The udev hardware database now also carries vendor/product information of SDIO devices. + The "sd-daemon.h" API gained a new sd_watchdog_enabled() to determine whether watchdog notifications are requested by the system manager. + Socket-activated per-connection services now include a short description of the connection parameters in the description. + tmpfiles gained a new "--boot" option. When this is not used, only lines where the command character is not suffixed with "!" are executed. When this option is specified, those options are executed too. + systemctl gained a new "import-environment" command which uploads the caller's environment (or parts thereof) into the service manager so that it is inherited by services started by the manager. This is useful to upload variables like $DISPLAY into the user service manager. + A new PrivateDevices= switch has been added to service units which allows running a service with a namespaced /dev directory that does not contain any device nodes for physical devices. More specifically, it only includes devices such as /dev/null, /dev/urandom, and /dev/zero which are API entry points. + logind has been extended to support behaviour like VT switching on seats that do not support a VT. This makes multi-session available on seats that are not the first seat (seat0), and on systems where kernel support for VTs has been disabled at compile-time. + If a process holds a delay lock for system sleep or shutdown and fails to release it in time, we will now log its identity. This makes it easier to identify processes that cause slow suspends or power-offs. + When parsing /etc/crypttab, support for a new key-slot= option as supported by Debian is added. It allows indicating which LUKS slot to use on disk, speeding up key loading. + The sd_journald_sendv() API call has been checked and officially declared to be async-signal-safe so that it may be invoked from signal handlers for logging purposes. + Boot-time status output is now enabled automatically after a short timeout if boot does not progress, in order to give the user an indication what she or he is waiting for. + The boot-time output has been improved to show how much time remains until jobs expire. + The KillMode= switch in service units gained a new possible value "mixed". If set, and the unit is shut down, then the initial SIGTERM signal is sent only to the main daemon process, while the following SIGKILL signal is sent to all remaining processes of the service. + logind will now also track a "Desktop" identifier for each session which encodes the desktop environment of it. This is useful for desktop environments that want to identify multiple running sessions of itself easily. + A new SELinuxContext= setting for service units has been added that allows setting a specific SELinux execution context for a service. + Most systemd client tools will now honour $SYSTEMD_LESS for settings of the "less" pager. + systemd's "seccomp" hook-up has been changed to make use of the libseccomp library instead of using its own implementation. This has benefits for portability among other things. - Dropped systemd patches as those are fixed upstream: * 0001-acpi-fptd-fix-memory-leak-in-acpi_get_boot_usec.patch * 0002-fix-lingering-references-to-var-lib-backlight-random.patch * 0003-acpi-make-sure-we-never-free-an-uninitialized-pointe.patch * 0004-systemctl-fix-name-mangling-for-sysv-units.patch * 0005-cryptsetup-fix-OOM-handling-when-parsing-mount-optio.patch * 0006-journald-add-missing-error-check.patch * 0007-bus-fix-potentially-uninitialized-memory-access.patch * 0008-dbus-fix-return-value-of-dispatch_rqueue.patch * 0009-modules-load-fix-error-handling.patch * 0010-efi-never-call-qsort-on-potentially-NULL-arrays.patch * 0011-strv-don-t-access-potentially-NULL-string-arrays.patch * 0012-mkdir-pass-a-proper-function-pointer-to-mkdir_safe_i.patch * 0014-tmpfiles.d-include-setgid-perms-for-run-log-journal.patch * 0001-systemd-order-remote-mounts-from-mountinfo-before-re.patch * 0001-gpt-auto-generator-exit-immediately-if-in-container.patch * 0001-manager-when-verifying-whether-clients-may-change-en.patch * 0001-logind-fix-bus-introspection-data-for-TakeControl.patch * 0001-mount-check-for-NULL-before-reading-pm-what.patch * 0001-shared-util-fix-off-by-one-error-in-tag_to_udev_node.patch * 0001-systemd-serialize-deserialize-forbid_restart-value.patch * 0001-core-unify-the-way-we-denote-serialization-attribute.patch * 0001-journald-fix-minor-memory-leak.patch * 0001-do-not-accept-garbage-from-acpi-firmware-performance.patch * 0001-journald-remove-rotated-file-from-hashmap-when-rotat.patch * 0001-login-fix-invalid-free-in-sd_session_get_vt.patch * 0001-login-make-sd_session_get_vt-actually-work.patch * 0001-Never-call-qsort-on-potentially-NULL-arrays.patch * 0001-dbus-common-avoid-leak-in-error-path.patch * 0001-drop-ins-check-return-value.patch * 0001-shared-util-Fix-glob_extend-argument.patch * 0001-Fix-bad-assert-in-show_pid_array.patch * 0001-analyze-set-white-background.patch * 0001-analyze-set-text-on-side-with-most-space.patch * analyze-fix-crash-in-command-line-parsing.patch * 0001-core-replace-OnFailureIsolate-setting-by-a-more-gene.patch * 0001-core-introduce-new-KillMode-mixed-which-sends-SIGTER.patch * 0002-service-allow-KillMode-mixed-in-conjunction-with-PAM.patch * 0003-core-make-sure-to-always-go-through-both-SIGTERM-and.patch * U_logind_revert_lazy_session_activation_on_non_vt_seats.patch * build-sys-make-multi-seat-x-optional.patch * 1017-skip-native-unit-handling-if-sysv-already-handled.patch * 0018-core-do-not-add-what-to-RequiresMountsFor-for-networ.patch * 0030-Fix-for-SIGSEGV-in-systemd-bootchart-on-short-living.patch * 0031-man-document-the-b-special-boot-option.patch * 0033-tmpfiles-log-unaccessible-FUSE-mount-points-only-as-.patch * 0034-systemd-python-fix-booted-and-add-two-functions-to-d.patch * 0035-activate-mention-E-in-the-help-text.patch * 0036-activate-fix-crash-when-s-is-passed.patch * 0037-tmpfiles-adjust-excludes-for-the-new-per-service-pri.patch * 0038-core-socket-fix-SO_REUSEPORT.patch * 0039-journal-when-appending-to-journal-file-allocate-larg.patch * 0040-journal-optimize-bisection-logic-a-bit-by-caching-th.patch * 0041-journal-fix-iteration-when-we-go-backwards-from-the-.patch * 0042-journal-allow-journal_file_copy_entry-to-work-on-non.patch * 0043-journal-simplify-pre-allocation-logic.patch * 0044-journald-mention-how-long-we-needed-to-flush-to-var-.patch * 0046-util.c-check-if-return-value-from-ttyname_r-is-0-ins.patch * 0047-docs-remove-unneeded-the-s-in-gudev-docs.patch * 0048-man-explicitly-say-when-multiple-units-can-be-specif.patch * 0049-systemd-treat-reload-failure-as-failure.patch - Dropped backported systemd patches as those are fixed upstream * 0145-logind-use-correct-who-enum-values-with-KillUnit.patch * 1011-check-4-valid-kmsg-device.patch * 0001-logind-garbage-collect-stale-users.patch - Dropped udev patches as those are fixed fixed upstream: * 0026-udevadm.xml-document-resolve-names-option-for-test.patch * 0032-rules-don-t-limit-some-of-the-rules-to-the-add-actio.patch - Modified patches * 1006-udev-always-rename-network.patch - Replaced patches * the patch 1012-pam_systemd_do_override_XDG_RUNTIME_DIR_of_the_original_user.patch is upstream now but has to be replaced by patch 0001-pam_systemd_do_override_XDG_RUNTIME_DIR_of_the_original_user.patch to fix an further issue similar to the upstream patch (bnc#852015) * the patch 0001-upstream-systemctl-halt-reboot-error-handling.patch is upstream now, only the part with the halt after a failed poweroff has been added to the patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch- Add patch 0001-make-209-working-on-older-dist.patch to make it usable on older distributions like 13.1- Add patch 0001-add-network-device-after-NFS-mount-units.patch to add "After" dependency to all NFS shares to the network interface device as this ensures at shutdown that the NFS share becomes unmounted before the interface is down (bnc#861489) +-------------------------------------------------------------------- enable compat-libs, BuildRequires binutils-gold ("old" ld fails on ifunc magic)- add network link configuration for udev- Modify patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch, move to core and link in directly to avoid libudev dep all over - Disable networkd - Disable compat-libs, adapt files section - add and remove some entries in the files section- Modify patch 1018-Make-LSB-Skripts-know-about-Required-and-Should.patch to avoid WantedBy for Should-Start/Start-Before/Start-After SysVinit scripts (bnc#863217)- Modify patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch to do a final sync() and flush the disks- Add several upstream bugfix patches which are missed: * 0018-core-do-not-add-what-to-RequiresMountsFor-for-networ.patch * 0026-udevadm.xml-document-resolve-names-option-for-test.patch * 0030-Fix-for-SIGSEGV-in-systemd-bootchart-on-short-living.patch * 0032-rules-don-t-limit-some-of-the-rules-to-the-add-actio.patch * 0031-man-document-the-b-special-boot-option.patch * 0033-tmpfiles-log-unaccessible-FUSE-mount-points-only-as-.patch * 0034-systemd-python-fix-booted-and-add-two-functions-to-d.patch * 0035-activate-mention-E-in-the-help-text.patch * 0036-activate-fix-crash-when-s-is-passed.patch * 0037-tmpfiles-adjust-excludes-for-the-new-per-service-pri.patch * 0038-core-socket-fix-SO_REUSEPORT.patch * 0039-journal-when-appending-to-journal-file-allocate-larg.patch * 0040-journal-optimize-bisection-logic-a-bit-by-caching-th.patch * 0041-journal-fix-iteration-when-we-go-backwards-from-the-.patch * 0042-journal-allow-journal_file_copy_entry-to-work-on-non.patch * 0043-journal-simplify-pre-allocation-logic.patch * 0044-journald-mention-how-long-we-needed-to-flush-to-var-.patch * 0046-util.c-check-if-return-value-from-ttyname_r-is-0-ins.patch * 0047-docs-remove-unneeded-the-s-in-gudev-docs.patch * 0048-man-explicitly-say-when-multiple-units-can-be-specif.patch * 0049-systemd-treat-reload-failure-as-failure.patch - Add patch 0001-Don-t-snprintf-a-potentially-NULL-pointer.patch to avoid potential NULL pointer - Reorder patches to reflect udev/systemd usage- don't build bash-completions for bootstrap package- add more requires to this-is-only-for-build-envs to avoid problems in kiwi configs- Add patch 0145-logind-use-correct-who-enum-values-with-KillUnit.patch to be able to kill sessions (bnc#860574)- Do not return from main shell script but simply exit (bnc#862789)- ... as only the systemd-analyze completion depends on bash-completion I prefere a without which has to be defined for SLES 12- avoid bootstrap cycle with libusb and systemd-mini- split bash-completion support into its own package, no need for sles_version- Split off systemd-rpm-macros as a separate package to avoid a rebuild of all packages due new systemd package - Define a sles_version 12 for suse_version 1315- Change and extend patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch to disable the workaround to find /dev/3270/tty1 as this now should be done by a) the kernel patch http://lkml.indiana.edu/hypermail/linux/kernel/1402.0/02319.html and the changed udev rule 99-systemd.rules- Remove PreReq pidof from udev, nothing in this pkg uses it- Change and extend patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch to re-enable colouring if 3270 console was enforced on the kernel command line as 3270 cna handle colour ANSI escape sequences. Also let the serial getty generator find the /dev/3270/tty1 character device (bnc#861316)- Add patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch to strip the colouring ANSI escape sequences from the console messages (bnc#860937)- Change patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch to skip already by the kernel managed devices- fix timeout stopping user@.service (bnc#841544) * 0001-core-introduce-new-KillMode-mixed-which-sends-SIGTER.patch * 0002-service-allow-KillMode-mixed-in-conjunction-with-PAM.patch * 0003-core-make-sure-to-always-go-through-both-SIGTERM-and.patch- Add patch 0001-upstream-systemctl-halt-reboot-error-handling.patch to be able to detect if the sysctl reboot() returns. - Add patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch A check for unmaintained disk like devices is added to be able to flush and maybe shut them down. Also the missing sync() system call is added for the direct halt/reboot systemctl command. Then the system halt is used as fallback if poweroff fails for both the direct poweroff systemctl command as well as for the systemd-shutdown utility.- Make systemd-mini build- Make requires bash-completion a recommends- Add patch 1017-skip-native-unit-handling-if-sysv-already-handled.patch to avoid that enabled boot scripts will be handled as unit files by systemctl status command (bnc#818044)- Drop patch 1017-enforce-sufficient-shutdown-warnings.patch as the original code behaves exactly as the shutdown code of the old SysVinit (bnc#750845) - Rename support-powerfail-with-powerstatus.patch to 1016-support-powerfail-with-powerstatus.patch- Add analyze-fix-crash-in-command-line-parsing.patch: fix crash in systemd-analyze (bnc#859365)- Add patch 1019-make-completion-smart-to-be-able-to-redirect.patch to make redirections work with the bash command completions for for systemd command tools (bnc#856858, bnc#859072)- Add patch 1018-Make-LSB-Skripts-know-about-Required-and-Should.patch to support the "+" to tag wanted dependencies as well as make sure that required dependencies are handles as required ones. This should fix bnc#858864 and bnc#857204.- apply preset also to service files that are new in upgrade- Change support-powerfail-with-powerstatus.patch to use BindsTo instead of BindTo- Add patch 1017-enforce-sufficient-shutdown-warnings.patch Warn once per hour in the last 3 hours, then all 30 minutes in last hour, all 15 minutes in the last 45 minutes, all 10 minutes in the last 15 minutes, and then all minute in the last 10 minutes (bnc#750845)- Add patch support-powerfail-with-powerstatus.patch and source file systemd-powerfail to implement SIGPWR support with evaluation of the file /var/run/powerstatus (bnc#737690)- Adapt patch 1011-check-4-valid-kmsg-device.patch to fit current upstream version maybe related to bnc#854884 - Change patch 1012-pam_systemd_do_override_XDG_RUNTIME_DIR_of_the_original_user.patch to check if XDG_RUNTIME_DIR is set before the call of pam_putenv() may fix bnc#855160- Disable multi-seat-x build, since package xorg-x11-server currently in Factory no longer needs it.- Added 0001-logind-garbage-collect-stale-users.patch: Don't stop a running user manager from garbage-collecting the user. Original behavior caused bnc#849870- Add build-sys-make-multi-seat-x-optional.patch * See: http://cgit.freedesktop.org/systemd/systemd/commit/?id=bd441fa27a22b7c6e11d9330560e0622fb69f297 * Now systemd-multi-seat-x build can be disabled with configure option - -disable-multi-seat-x. It should be done when xorg-x11-server no longer needs it (work in progress).- Update insserv-generator.patch: fix crash in insserv generator (bnc#854314). - Update apply-ACL-for-nvidia-device-nodes.patch with latest fixes for Nvidia cards (bnc#808319).- Add patch 1014-journald-with-journaling-FS.patch which now uses the file system ioctls for switching off atime, compression, and copy-on-write of the journal directory of the the systemd-journald (bnc#838475) - Let us build require the package config for libpcre (bnc#853293)- Add patch 0001-core-replace-OnFailureIsolate-setting-by-a-more-gene.patch Make sure emergency shell is not killed by attempt to start another unit (bnc#852021). Backported from d420282b28f50720e233ccb1c02547c562195653. - Add patch make-emergency.service-conflict-with-syslog.socket.patch Previous patch did not fix problem if syslog connection request came after emergency shell was already started. So forcibly stop syslog.socket when starting emergency.service. (bnc#852232)- Add U_logind_revert_lazy_session_activation_on_non_vt_seats.patch * See: http://cgit.freedesktop.org/systemd/systemd/commit/?id=3fdb2494c1e24c0a020f5b54022d2c751fd26f50- Add patch 1012-pam_systemd_do_override_XDG_RUNTIME_DIR_of_the_original_user.patch to avoid (xdg-)su to set XDG_RUNTIME_DIR to the original user and avoid that e.g. pulseaudio will create /run/user//pulse owned by root (bnc#852015)- Add patch 1011-check-4-valid-kmsg-device.patch to avoid a busy systemd-journald (bnc#851393)- Add patch 1010-do-not-install-sulogin-unit-with-poweroff.patch that is do not install console-shell.service in any system target as this will cause automatic poweroff at boot (bnc#849071)- Add upstream patch 0001-analyze-set-text-on-side-with-most-space.patch to place the text on the side with most space- Add upstream patch 0001-analyze-set-white-background.patch to make SVG output of systemd analyze readable- Add patch 1009-make-xsltproc-use-correct-ROFF-links.patch to have valid ROFF links in manual pages working again (bnc#842844)- Add 0001-gpt-auto-generator-exit-immediately-if-in-container.patch: don't start gpt auto-generator in container (git). - Add 0001-manager-when-verifying-whether-clients-may-change-en.patch: fix reload check in selinux case (git). - Add 0001-logind-fix-bus-introspection-data-for-TakeControl.patch: fix introspection for TakeControl (git). - Add 0001-mount-check-for-NULL-before-reading-pm-what.patch: fix crash when parsing some incorrect unit (git). - Add 0001-shared-util-fix-off-by-one-error-in-tag_to_udev_node.patch: Fix udev rules parsing (git). - Add 0001-systemd-serialize-deserialize-forbid_restart-value.patch: Fix incorrect deserialization for forbid_restart (git). - Add 0001-core-unify-the-way-we-denote-serialization-attribute.patch: Ensure forbid_restart is named like other attributes (git). - Add 0001-journald-fix-minor-memory-leak.patch: fix memleak in journald (git). - Add 0001-do-not-accept-garbage-from-acpi-firmware-performance.patch: Improve ACPI firmware performance parsing (git). - Add 0001-journald-remove-rotated-file-from-hashmap-when-rotat.patch: Fix journal rotation (git). - Add 0001-login-fix-invalid-free-in-sd_session_get_vt.patch: Fix memory corruption in sd_session_get_vt (git). - Add 0001-login-make-sd_session_get_vt-actually-work.patch: Ensure sd_session_get_vt returns correct value (git). - Add 0001-Never-call-qsort-on-potentially-NULL-arrays.patch: Don't call qsort on NULL arrays (git). - Add 0001-dbus-common-avoid-leak-in-error-path.patch: Fix memleak in dbus-common code (git). - Add 0001-drop-ins-check-return-value.patch: Fix return value for drop-ins checks (git). - Add 0001-shared-util-Fix-glob_extend-argument.patch: Fix glob_extend argument (git). - Add 0001-Fix-bad-assert-in-show_pid_array.patch: Fix bad assert in show_pid_array (git).- Add 0001-acpi-fptd-fix-memory-leak-in-acpi_get_boot_usec.patch: fix acpi memleak. - Add 0002-fix-lingering-references-to-var-lib-backlight-random.patch: fix invalid path in documentation. - Add 0003-acpi-make-sure-we-never-free-an-uninitialized-pointe.patch: fix invalid memory free. - Add 0004-systemctl-fix-name-mangling-for-sysv-units.patch: fix name mangling for sysv units. - Add 0005-cryptsetup-fix-OOM-handling-when-parsing-mount-optio.patch: fix OOM handling. - Add 0006-journald-add-missing-error-check.patch: add missing error check. - Add 0007-bus-fix-potentially-uninitialized-memory-access.patch: fix uninitialized memory access. - Add 0008-dbus-fix-return-value-of-dispatch_rqueue.patch: fix return value. - Add 0009-modules-load-fix-error-handling.patch: fix error handling. - Add 0010-efi-never-call-qsort-on-potentially-NULL-arrays.patch: fix incorrect memory access. - Add 0011-strv-don-t-access-potentially-NULL-string-arrays.patch: fix incorrect memory access. - Add 0012-mkdir-pass-a-proper-function-pointer-to-mkdir_safe_i.patch: fix invalid pointer. - Add 0014-tmpfiles.d-include-setgid-perms-for-run-log-journal.patch: fix permission on /run/log/journal. - Add 0001-systemd-order-remote-mounts-from-mountinfo-before-re.patch: order remote mount points properly before remote-fs.target.- Explicitly require pam-config for %post of the main package- Release v208: + logind gained support for facilitating privileged input and drm devices access for unprivileged clients (helps Wayland / kmscon). + New kernel command line luks.options= allows to specify LUKS options, when used with luks.uuid= + tmpfileS.d snippets can uses specifier expansion in path names (%m, %b, %H, %v). + New tmpfiles.d command "m" introduced to change owner/group/access mode of a file/directory only if it exists. + MemorySoftLimit= cgroup settings is no longer supported (underlying kernel cgroup attribute will disappear in the future). + memeory.use_hierarchy cgroup attribute is enabled for all cgroups systemd creates in memory cgroup hierarchy. + New filed _SYSTEMD_SLICE= is logged in journal messages related to a slice. + systemd-journald will no longer adjust the group of journal files it creates to "systemd-journal" group. Permissions and owernship is adjusted when package is upgraded. + Backlight and random seed files are now stored in /var/lib/systemd. + Boot time performance measurements included ACPI 5.0 FPDT informations if available. - Drop merged patches: 0001-cgroup-add-the-missing-setting-of-variable-s-value.patch, 0002-cgroup-correct-the-log-information.patch, 0003-cgroup-fix-incorrectly-setting-memory-cgroup.patch, 0004-random-seed-we-should-return-errno-of-failed-loop_wr.patch, 0005-core-cgroup-first-print-then-free.patch, 0006-swap-fix-reverse-dependencies.patch, 0008-swap-create-.wants-symlink-to-auto-swap-devices.patch, 0009-polkit-Avoid-race-condition-in-scraping-proc.patch, Fix-timeout-when-stopping-Type-notify-service.patch, set-ignoreonisolate-noauto-cryptsetup.patch, 0001-Fix-buffer-overrun-when-enumerating-files.patch, 0007-libudev-fix-move_later-comparison.patch. - Refresh patches remain_after_exit-initscript-heuristic-and-add-new-LSB-hea.patch, delay-fsck-cryptsetup-after-md-dmraid-lvm-are-started.patch, handle-root_uses_lang-value-in-etc-sysconfig-language.patch, handle-SYSTEMCTL_OPTIONS-environment-variable.patch, Revert-service-drop-support-for-SysV-scripts-for-the-early.patch. - Own more ghost files. - Do not run pam-config in systemd-mini %post. - Add after-local.service to run after.local late during the boot process (bnc#778715).- Update Fix-timeout-when-stopping-Type-notify-service.patch with upstream fix. - No longer start ask-password-wall, was causing too much spam on terminals (bnc#747783).- Add set-ignoreonisolate-noauto-cryptsetup.patch: ensure noauto encrypted mounts survives runlevel changes (bnc#843085). - Add 0001-Fix-buffer-overrun-when-enumerating-files.patch: fix logind crash when /run/systemd/sessions was too big (bnc#840055, initial fix from hpj@suse.com). - Update sysctl-handle-boot-sysctl.conf-kernel_release.patch to only check for /boot/sysctl.conf- presence. - Add service wrapper for after.local (bnc#778715).- Update use-usr-sbin-sulogin-for-emergency-service.patch to apply to all services using sulogin and remove generated files from upstream tarball (bnc#841398).- Fix-timeout-when-stopping-Type-notify-service.patch Make sure MAINPID is watched when it becomes known (bnc#841544)- Remove output and error redirection to /dev/null in install script, it might help tracing pam related issue (bnc#841573).- Move symlink migration trigger to post (bnc#821800).- 0009-polkit-Avoid-race-condition-in-scraping-proc.patch VUL-0: polkit: process subject race condition [bnc#835827] CVE-2013-4288- Build with --disable-ima as the openSUSE kernel does not support IMA (CONFIG_IMA is not set)- Build with --disable-smack as the openSUSE kernel does not support smack (CONFIG_SECURITY_SMACK is not set)- Don't use a trigger to create symlink for sysctl.conf, always run the test on %post (bnc#840864). - Update sysctl-handle-boot-sysctl.conf-kernel_release.patch to ensure /boot is mounted before reading /boot/sysctl.conf-* (bnc#809420).- 0008-swap-create-.wants-symlink-to-auto-swap-devices.patch really fixes the swap unit problem mentioned in previous commit & the opensuse-factory mailing list.- 0001-cgroup-add-the-missing-setting-of-variable-s-value.patch missing important check on return value. - 0002-cgroup-correct-the-log-information.patch fix misleading log information. - 0003-cgroup-fix-incorrectly-setting-memory-cgroup.patch fix setting memory cgroup - 0004-random-seed-we-should-return-errno-of-failed-loop_wr.patch should fail if write fails. - 0005-core-cgroup-first-print-then-free.patch use-after-free will trigger if there is an error condition. - 0006-swap-fix-reverse-dependencies.patch reported in opensuse-factory list, topic "swap isn't activated" - 0007-libudev-fix-move_later-comparison.patch libudev invalid usage of "move_later".- while testing this new release I get in the logs ocassionally at boot "systemd[1]: Failed to open private bus connection: Failed to connect to socket /var/run/dbus/system_bus_socket: No such file or directory" indeed DBUS_SYSTEM_BUS_DEFAULT_ADDRESS is defined to /var/run/dbus/system_bus_socket instead of /run/dbus/system_bus_socket and that does not fly when /var/run is not yet available. (systemd-dbus-system-bus-address.patch)- Enable Predictable Network interface names (bnc#829526).- version 207, distribution specific changes follow, for overall release notes see NEWS. - Fixed: * Failed at step PAM spawning /usr/lib/systemd/systemd: Operation not permitted * Fix shutdown hang "a stop job is running for Session 1 of user root" that was reported in opensuse-factory list. - systemd-sysctl no longer reads /etc/sysctl.conf however backward compatbility is to be provides by a symlink created at %post. - removed previously disabled upstream patches (merged): 0002-core-mount.c-mount_dump-don-t-segfault-if-mount-is-n.patch, 0004-disable-the-cgroups-release-agent-when-shutting-down.patch, 0005-cgroups-agent-remove-ancient-fallback-code-turn-conn.patch, 0006-suppress-status-message-output-at-shutdown-when-quie.patch, - removed upstream merged patches: exclude-dev-from-tmpfiles.patch, logind_update_state_file_after_generating_....patch - Add systemd-pam_config.patch: use correct include name for PAM configuration on openSUSE.- Add exclude-dev-from-tmpfiles.patch: allow to exclude /dev from tmpfiles (bnc#835813).- Remove force-lvm-restart-after-cryptsetup-target-is-reached.patch and remove additional dependencies on LVM in other patches: LVM has now systemd support, no need to work around it anymore in systemd.- Add patch logind_update_state_file_after_generating_the_session_fifo_not_before.patch to fix https://bugs.freedesktop.org/show_bug.cgi?id=67273- explicitly enable getty@tty1.service instead of getty@.service as the tty1 alias has been removed from the file (bnc#833494)- Ensure /usr/lib/systemd/system/shutdown.target.wants is created and owned by systemd package.- Fix drop-in for getty@tty1.service- Move systemd-journal-gateway to subpackage to lower dependencies in default install.- version 206 , highlights: * Unit files now understand the new %v specifier which resolves to the kernel version string as returned by "uname-r". * "journalctl -b" may now be used to look for boot output of a specific boot. Try "journalctl -b -1" * Creation of "dead" device nodes has been moved from udev into kmod and tmpfiles. * The udev "keymap" data files and tools to apply keyboard specific mappings of scan to key codes, and force-release scan code lists have been entirely replaced by a udev "keyboard" builtin and a hwdb data file. - remove patches now in upstream - systemd now requires libkmod >=14 and cryptsetup >= 1.6.0 - systemd now require the kmod tool in addition to the library.- use-usr-sbin-sulogin-for-emergency-service.patch emergency.service failed to start because sulogin is in /usr/sbin now- fix build with rpm-4.11.1: /etc/xdg/system/user is a symlink, not a directory- 0002-core-mount.c-mount_dump-don-t-segfault-if-mount-is-n.patch fix segfault at shutdown - 0004-disable-the-cgroups-release-agent-when-shutting-down.patch disable the cgroups release agent when shutting down. - 0005-cgroups-agent-remove-ancient-fallback-code-turn-conn.patch remove ancient fallback code; turn connection error into warning - 006-suppress-status-message-output-at-shutdown-when-quie.patch make shutdown honour "quiet" kernel cmdline.- fix broken symlink, service is called systemd-random-seed now.- Update to release 205: + two new unit types have been introduced: - Scope units are very similar to service units, however, are created out of pre-existing processes -- instead of PID 1 forking off the processes. - Slice units may be used to partition system resources in an hierarchial fashion and then assign other units to them. By default there are now three slices: system.slice (for all system services), user.slice (for all user sessions), machine.slice (for VMs and containers). + new concept of "transient" units, which are created at runtime using an API and not based on configuration from disk. + logind has been updated to make use of scope and slice units to manage user sessions. Logind will no longer create cgroups hierchies itself but will relying on PID 1. + A new mini-daemon "systemd-machined" has been added which may be used by virtualization managers to register local VMs/containers. machinectl tool has been added to query meta-data from systemd-machined. + Low-level cgroup configuration options ControlGroup=, ControlGroupModify=, ControlGroupPersistent=, ControlGroupAttribute= have been removed. High-level attribute settings or slice units should be used instead? + A new bus call SetUnitProperties() has been added to alter various runtime parameters of a unit, including cgroup parameters. systemctl gained set-properties command to wrap this call. + A new tool "systemd-run" has been added which can be used to run arbitrary command lines as transient services or scopes, while configuring a number of settings via the command line. + nspawn will now inform the user explicitly that kernels with audit enabled break containers, and suggest the user to turn off audit. + Support for detecting the IMA and AppArmor security frameworks with ConditionSecurity= has been added. + journalctl gained a new "-k" switch for showing only kernel messages, mimicking dmesg output; in addition to "--user" and "--system" switches for showing only user's own logs and system logs. + systemd-delta can now show information about drop-in snippets extending unit files. + systemd will now look for the "debug" argument on the kernel command line and enable debug logging, similar to "systemd.log_level=debug" already did before. + "systemctl set-default", "systemctl get-default" has been added to configure the default.target symlink, which controls what to boot into by default. + "systemctl set-log-level" has been added as a convenient way to raise and lower systemd logging threshold. + "systemd-analyze plot" will now show the time the various generators needed for execution, as well as information about the unit file loading. + libsystemd-journal gained a new sd_journal_open_files() call for opening specific journal files. journactl also gained a new switch to expose this new functionality (useful for debugging). + systemd gained the new DefaultEnvironment= setting in /etc/systemd/system.conf to set environment variables for all services. + If a privileged process logs a journal message with the OBJECT_PID= field set, then journald will automatically augment this with additional OBJECT_UID=, OBJECT_GID=, OBJECT_COMM=, OBJECT_EXE=, ... fields. This is useful if system services want to log events about specific client processes. journactl/systemctl has been updated to make use of this information if all log messages regarding a specific unit is requested. - Remove 0001-journal-letting-interleaved-seqnums-go.patch, 0002-journal-remember-last-direction-of-search-and-keep-o.patch, 0004-journald-DO-recalculate-the-ACL-mask-but-only-if-it-.patch, 0006-systemctl-core-allow-nuking-of-symlinks-to-removed-u.patch, 0008-service-don-t-report-alien-child-as-alive-when-it-s-.patch, 0160-mount-when-learning-about-the-root-mount-from-mounti.patch, 0185-core-only-attempt-to-connect-to-a-session-bus-if-one.patch, Start-ctrl-alt-del.target-irreversibly.patch, systemctl-does-not-expand-u-so-revert-back-to-I.patch: merged upstream. - Regenerate patches 1007-physical-hotplug-cpu-and-memory.patch, 1008-add-msft-compability-rules.patch, Revert-service-drop-support-for-SysV-scripts-for-the-early.patch, fix-support-for-boot-prefixed-initscript-bnc-746506.patch, handle-SYSTEMCTL_OPTIONS-environment-variable.patch, handle-numlock-value-in-etc-sysconfig-keyboard.patch, insserv-generator.patch, optionally-warn-if-nss-myhostname-is-called.patch, remain_after_exit-initscript-heuristic-and-add-new-LSB-hea.patch, restore-var-run-and-var-lock-bind-mount-if-they-aren-t-sym.patch, service-flags-sysv-service-with-detected-pid-as-RemainAfte.patch. - Update macros.systemd.upstream with latest upstream revision.- Replace parse-etc-insserv.conf-and-adds-dependencies-accordingly.patch patch with insserv-generator.patch: no longer patch systemd main binary but generate systemd drop-in files using a generator, for insserv.conf compatibility.- systemd-mini doesn't need dbus-1, only dbus-1-devel- Re-add fixed udev MSFT compability rules (bnc#805059, bnc#826528). add: 1008-add-msft-compability-rules.patch- Drop 1007-add-msft-compability-rules.patch, breaks boot and links in /dev/disk/by-id, will need proper rework (bnc#826528).- 0160-mount-when-learning-about-the-root-mount-from-mounti.patch Another case where we are trying to umount the root directory at shutdown. - 0185-core-only-attempt-to-connect-to-a-session-bus-if-one.patch only attempt to connect to a session bus if one likely exists- Automatically online CPUs/Memory on CPU/Memory hotplug add events (bnc#703100, fate#311831). add: 1008-physical-hotplug-cpu-and-memory.patch- Dropped backward compatibility - Added check for upstream rpm macros changes- Split out RPM macros into separate package to simplify dependencies- 0001-journal-letting-interleaved-seqnums-go.patch and 0002-journal-remember-last-direction-of-search-and-keep-o.patch fix possible infinite loops in the journal code, related to bnc #817778- Explicitly list libattr-devel as BuildRequires - More robust make install call. Remove redundant %clean section.- Cleanup NumLock setting code (handle-numlock-value-in-etc-sysconfig-keyboard.patch).- Only apply 1007-add-msft-compability-rules.patch when not building systemd-mini.- Add udev MSFT compability rules (bnc#805059). add: 1007-add-msft-compability-rules.patch - Add sg3_utils requires, need it by 61-msft.rules (bnc#805059). - Clean-up spec file, put udev patches after systemd patches. - Rebase patches so they would apply nicely.- 0004-journald-DO-recalculate-the-ACL-mask-but-only-if-it-.patch fixes : * systemd-journald[347]: Failed to set ACL on /var/log/journal/11d90b1c0239b5b2e38ed54f513722e3/user-1000.journal, ignoring: Invalid argument - 006-systemctl-core-allow-nuking-of-symlinks-to-removed-u.patch systemctl disable should remove dangling symlinks. - 0008-service-don-t-report-alien-child-as-alive-when-it-s-.patch alien childs are reported as alive when they are really dead.- Update to release 204: + systemd-nspawn creates etc/resolv.conf in container if needed. + systemd-nspawn will store metadata about container in container cgroup including its root directory. + cgroup hierarchy has been reworked, all objects are now suffxed (with .session for user sessions, .user for users, .nspawn for containers). All cgroup names are now escaped to preven collision of object names. + systemctl list-dependencies gained --plain, --reverse, --after and --before switches. + systemd-inhibit shows processes name taking inhibitor lock. + nss-myhostname will now resolve "localhost" implicitly. + .include is not allowed recursively anymore and only in unit files. Drop-in files should be favored in most cases. + systemd-analyze gained "critical-chain" command, to get slowest chain of units run during boot-up. + systemd-nspawn@.service has been added to easily run nspawn container for system services. Just start "systemd-nspawn@foobar.service" and container from /var/lib/container/foobar" will be booted. + systemd-cgls has new --machine parameter to list processes from one container. + ConditionSecurity= can now check for apparmor and SMACK. + /etc/systemd/sleep.conf has been introduced to configure which kernel operation will be execute when "suspend", "hibernate" or "hybrid-sleep" is requrested. It allow new kernel "freeze" state to be used too. (This setting won't have any effect if pm-utils is installed). + ENV{SYSTEMD_WANTS} in udev rules will now implicitly escape passed argument if applicable. - Regenerate some patches for this new release. - Rename hostname-setup-shortname.patch to ensure-shortname-is-set-as-hostname-bnc-820213.patch to be git format-patch friendly. - Update apply-ACL-for-nvidia-device-nodes.patch to apply ACL to /dev/nvidia* (bnc#808319). - Remove Ensure-debugshell-has-a-correct-value.patch, doable with a configure option. - Add systemctl-does-not-expand-u-so-revert-back-to-I.patch: avoids expansion errors. - Add Start-ctrl-alt-del.target-irreversibly.patch: ctrl-alt-del should be irreversible for reliability.- Drop Add-bootsplash-handling-for-password-dialogs.patch bootsplash support has been removed from the kernel. - Drop ensure-systemd-udevd-is-started-before-local-fs-pre-for-lo.patch fixed in systemd v199, commit 89d09e1b5c65a2d97840f682e0932c8bb499f166 - Apply rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch only on ARM, patch rejected upstream because is too generic. - no such define TARGET_SUSE exists but it is used in Revert-service-drop-support-for-SysV-scripts-for-the-early.patch use HAVE_SYSV_COMPAT instead.- Do no ship defaults for sysctl, they should be part of aaa_base (currently in procps). - Add hostname-setup-shortname.patch: ensure shortname is set as hostname (bnc#820213).- Rebase parse-etc-insserv.conf-and-adds-dependencies-accordingly.patch to fix memory corruption (thanks to Michal Vyskocil) (bnc#820454).- Add sysctl-handle-boot-sysctl.conf-kernel_release.patch: ensure /boot/sysctl.conf- is handled (bnc#809420).- Update handle-SYSTEMCTL_OPTIONS-environment-variable.patch: don't free variable whose content is still be used (bnc#819970).- Add configure flags to ensure boot.local/halt.local are run on startup/shutdown.- Fix firmware loading by enabling --with-firmware-path (bnc#817551).- Fix systemd-sysv-convert, so empty runlevel folders don't lead to "line 44: [: too many arguments"- Fix handle-etc-HOSTNAME.patch to properly set hostname at startup when using /etc/HOSTNAME.- Rename remaning udev patches (clean-up). - Generate %{_libexecdir}/modules-load.d/sg.conf so we load sg module at boot time not from udev (bnc#761109). - Drop unused patches: 1001-Reinstate-TIMEOUT-handling.patch 1005-udev-fix-sg-autoload-regression.patch 1026-re-add-persistent-net.patch- Use drop-in file to fix bnc#804158.- add some more conflicts to make bootstrap work- Do not provide %{release} for systemd-analyze - Add more conflicts to -mini packages - Disable Predictable Network interface names until it has been reviewed by network team, with /usr/lib/tmpfiles.d/network.conf. - Don't package /usr/lib/firmware/update (not used)- Fix packaging error, there is no syslog.target anymore do not pretend there is one.- Update to release 202: + 'systemctl list-jobs' got some polishing. '--type=' argument may now be passed more than once. 'systemctl list-sockets' has been added. + systemd gained a new unit 'systemd-static-nodes.service' that generates static device nodes earlier during boot, and can run in conjunction with udev. + systemd-nspawn now places all containers in the new /machine top-level cgroup directory in the name=systemd hierarchy. + bootchart can now store its data in the journal. + journactl can now take multiple --unit= and --user-unit= switches. + The cryptsetup logic now understands the "luks.key=" kernel line switch. If a configured key file is missing, it will fallback to prompting the user. - Rebase some patches - Update handle-SYSTEMCTL_OPTIONS-environment-variable.patch to properly handle SYSTEMCTL_OPTIONS- Fix regression in the default for tmp auto-deletion (systemd-tmp-safe-defaults.patch, FATE#314974).- Update to release 201: + udev now supports different nameng policies for network interface for predictable names. + udev gained support for loading additional device properties from an indexed database. %udev_hwdb_update macro should be used by packages adding entries to this database. + Journal gained support for "Message Catalog", indexed database to link up additional information with journal entries. %journal_catalog_update macro should be used by packages adding %entries to this database. + "age" field for tmpfiles entries can be set to 0, forcing removal of files matching this entry. + coredumpctl gained "gdb" verb to invoke gdb on selected coredump. + New rpm macros has been added: %udev_rules_update(), %_udevhwdbdir, %_udevrulesdir, %_journalcatalogdir, %_tmpfilesdir, %_sysctldir. + In service files, %U can be used for configured user name of the service. + nspawn can be invoked without a controlling TTY. + systemd and nspawn can accept socket file descriptors when started for socket activation. This allow socket activated nspawn containers. + logind can now automatically suspend/hibernate/shutdown system on idle. + ConditionACPower can be used in unit file to detect if AC power source is connected or if system is on battery power. + EnvironmentFile= in unit files supports file globbing. + Behaviour of PrivateTmp=, ReadWriteDirectories=, ReadOnlyDirectories= and InaccessibleDirectories= has changed. The private /tmp and /var/tmp directories are now shared by all processes of a service (which means ExecStartPre= may now leave data in /tmp that ExecStart= of the same service can still access). When a service is stopped its temporary directories are immediately deleted (normal clean-up with tmpfiles is still done in addition to this though). + Resource limits (as exposed by cgroup controlers) can be controlled dynamically at runtime for all units, using "systemctl set-cgroup-attr foobar.server cgroup.attribute value". Those settings are stored persistenly on disk. + systemd-vconsole-setup will now copy all fonts settings to all allocated VTs. + timedated now exposes CanNTP property to indicate if a local NTP service is available. + pstore file system is mounted by default, if available. + SMACK policies are loaded at early boot, if available. + Timer units now support calendar time events. + systemd-detect-virt detect xen PVs. + Some distributions specific LSB targets has been dropped: $x-display-manager, $mail-transfer-agent, $mail-transport-agent, $mail-transfer-agent, $smtp, $null. As well mail-transfer-agent.target and syslog.target has been removed. + systemd-journal-gatewayd gained SSL support and now runs as unprivileged user/group "systemd-journal-gateway:systemd-journal-gateway" + systemd-analyze will read, when available, boot time performance from EFI variable from boot loader supporting it. + A new generator for automatically mounting EFI System Partition (ESP) to /boot (if empty and no other file system has been configured in fstab for it). + logind will now send out PrepareForSleep(false) out unconditionally, after coming back from suspend. + tmpfiles gained a new "X" line type, that allows configuration of files and directories (with wildcards) that shall be excluded from automatic cleanup ("aging"). + udev default rules set the device node permissions now only at "add" events, and do not change them any longer with a later "change" event. + A new bootctl tool has been added that is an interface for certain EFI boot loader operations. + A new tool kernel-install has been added to install kernel images according to Boot Loader Specification. + A new tool systemd-activate can be used to test socket activation. + A new group "systemd-journal" is now owning journal files, replacing "adm" group. + journalctl gained "--reverse" to show output in reverse order, "--pager-end" to jump at the end of the journal in the pager (only less is supported) and "--user-unit" to filter for user units. + New unit files has been addedto ease for systemd usage in initrd. + "systemctl start" now supports "--irreversible" to queue operations which can be reserved. It is now used to make shutdown requests more robust. + Auke Kok's bootchart has been merged and relicensed to LGPLv2.1+. + nss-myhostname has been merged in systemd codebase. + some defaults sysctl values are now set by default: the safe sysrq options are turned on, IP route verification is turned on, and source routing disabled. The recently added hardlink and softlink protection of the kernel is turned on. + Add support for predictable network naming logic. It can be turned off with kernel command line switch: net.ifnames=0 + journald will now explicitly flush journal files to disk at the latest 5 min after each write and will mark file offline until next read. This should increase reliability in case of crash. + remote-fs-setup.target target has been added to pull in specific services when at least one remote file system is to be mounted. + timers.target and paths.target have been added as canonical targets to pull user timer and path units, similar to sockets.targets. + udev daemon now sets default number of worker processes in parallel based on number of CPUs instead of RAM. + Most unit file settings which takes likst of items can now be reset by assigning empty string to them, using drop-in. + Add support for drop-in configuration file for units. + Most unit file settings which takes likst of items can now be reset by assigning empty string to them, using drop-in. + improve systemg-cgtop output. + improve 'systemctl status' output for socket, drop-in for units. + 'hostnamectl set-hostname' allows setting FQDN hostnames. + fractional time intervals are now parsed properly. + localectl can list available X11 keymaps. + systemd-analyze dot can filter for specific units and has been rewritten in C. + systemctl gained "list-dependencies" command. + Inhibitors are now honored no only in GNOME. - Many patches has been dropped, being merged upstream. - Many patches has been renamed and regenerated with git, to have consistent naming, authorship and comments embedded. - Add Revert-service-drop-support-for-SysV-scripts-for-the-early.patch: re-add support for boot.* initscripts until they are all migrated to systemd unit files. - Merge patches for nss-myhostname package to this package.- Add chromebook lid switch as a power switch to logind rule to enable suspend on lid close- Add improve-readahead-spinning.patch: improve readahead performance on spinning media with ext4. - Add fix-journal-vacuum-logic.patch: fix vacuum logic in journal (bnc#789589). - Add fix-lsb-provides.patch: ensure LSB provides are correctly handled if also referenced as dependencies (bnc#809646). - Add fix-loopback-mount.patch: ensure udevd is started (and therefore static devices are created) before mounting (bnc#809820). - Update systemd-sysv-convert to search services files in new location (bnc#809695). - Add logind-nvidia-acl.diff: set ACL on nvidia devices (bnc#808319). - Add do-no-isolate-on-fsck-failure.patch: do not turn off services if fsck fails (bnc#812874) - Add wait-for-processes-killed.patch: wait for processes killed by SIGTERM before killing them with SIGKILL. - Update systemctl-options.patch to only apply SYSTEMCTL_OPTIONS to systemctl command (bnc#801878).- Fixed disabling CapsLock and enabling NumLock (bnc#746595, 0001-handle-disable_caplock-and-compose_table-and-kbd_rat.patch, systemd-numlock-suse.patch). - Explicitly require libgcrypt-devel to fix build failure.- udev: ensure that the network interfaces are renamed even if they exist (bnc#809843). add: 1027-udev-always-rename-network.patch- udev: re-add persistent network rules (bnc#809843). add: 1026-re-add-persistent-net.patch - rebase all patches, ensure that they apply properly.- Add rbind-mount.patch: handle rbind mount points correctly (bnc#804575).- Ensure journal is flushed on disk when systemd-logger is installed for the first time. - Add improve-journal-perf.patch: improve journal performance on query. - Add support-hybrid-suspend.patch: add support for hybrid suspend. - Add forward-to-pmutils.patch: forward suspend/hibernation calls to pm-utils, if installed (bnc#790157).- udev: usb_id: parse only 'size' bytes of the 'descriptors' buffer add: 1024-udev-usb_id-parse-only-size-bytes-of-the-descriptors.patch - udev: expose new ISO9660 properties from libblkid add: 1025-udev-expose-new-ISO9660-properties-from-libblkid.patch- Create getty@tty1.service to restore traditional SUSE behavior of not clearing tty1. (bnc#804158) - Better use of find -exec- Add early-sync-shutdown.patch: start sync just when shutdown.target is beginning - Update parse-multiline-env-file.patch to better handle continuing lines. - Add handle-HOSTNAME.patch: handle /etc/HOSTNAME (bnc#803653). - Add systemctl-print-wall-on-if-successful.patch: only print on wall if successful. - Add improve-bash-completion.patch: improve bash completion.- disable nss-myhostname warning (bnc#783841) => disable-nss-myhostname-warning-bnc-783841.diff- rework patch: 1020-usb_id-some-strange-devices-have-a-very-bogus-or-strage-serial.patch - udev: use unique names for temporary files created in /dev. add: 1022-udev-use-unique-names-for-temporary-files-created-in.patch - cdrom_id: add data track count for bad virtual drive. add: 1023-cdrom_id-add-data-track-count-for-bad-virtual-drive.patch- usb_id: ensure we have a valid serial number as a string (bnc#779493). add: 1020-usb_id-some-strange-devices-have-a-very-bogus-or-strage-serial.patch - cdrom_id: created links for the default cd/dvd drive (bnc#783054). add: 1021-create-default-links-for-primary-cd_dvd-drive.patch- Add cryptsetup-accept-read-only.patch: accept "read-only" in addition to "readonly" in crypttab - Update parse-multiline-env-file.patch to correctly handle commented lines (bnc#793411)- udev: Fix device matching in the accelerometer add: 1019-udev-Fix-device-matching-in-the-accelerometer.patch - keymap: add aditional support for some keyboard keys add: 1018-keymap-add-aditional-support.patch - journalctl: require argument for --priority add: journalctl-require-argument-for-priority - dropped useless patches: libudev-validate-argument-udev_enumerate_new.patch kmod-fix-builtin-typo.patch - rename udev-root-symlink.service to systemd-udev-root-symlink.service. - fix in udev package missing link in basic.target.wants for systemd-udev-root-symlink.service- Add tmpfiles-X-type.patch: allow to clean directories with removing them. - Add systemd-fix-merge-ignore-dependencies.patch: fix merging with - -ignore-dependencies waiting for dependencies (bnc#800365). - Update systemd-numlock-suse.patch: udev-trigger.service is now called systemd-udev-trigger.service. - Add improve-man-environment.patch: improve manpage regarding Environment value.- Add systemctl-options.patch: handle SYSTEMCTL_OPTIONS internaly (bnc#798620). - Update crypt-loop-file.patch to correctly detect crypto loop files (bnc#799514). - Add journalctl-remove-leftover-message.patch: remove debug message in systemctl. - Add job-avoid-recursion-when-cancelling.patch: prevent potential recursion when cancelling a service. - Add sysctl-parse-all-keys.patch: ensure sysctl file is fully parsed. - Add journal-fix-cutoff-max-date.patch: fix computation of cutoff max date for journal. - Add reword-rescue-mode-hints.patch: reword rescue prompt. - Add improve-overflow-checks.patch: improve time overflow checks. - Add fix-swap-behaviour-with-symlinks.patch: fix swap behaviour with symlinks. - Add hostnamectl-fix-set-hostname-with-no-argument.patch: ensure hostnamectl requires an argument when called with set-hostname option. - Add agetty-overrides-term.patch: pass correctly terminal type to agetty. - Add check-for-empty-strings-in-strto-conversions.patch: better check for empty strings in strto* conversions. - Add strv-cleanup-error-path-loops.patch: cleanup strv on error path. - Add cryptsetup-handle-plain.patch: correctly handle "plain" option in cryptsetup. - Add fstab-generator-improve-error-message.patch: improve error message in fstab-generator. - Add delta-accept-t-option.patch: accept -t option in systemd-delta. - Add highlight-ordering-cycle-deletions.patch: highlight ordering cycle deletions in logs. - Add core-interpret-escaped-semicolon-as-escaped.patch: accept \; in ExecStart. - Add hostnamectl-fix-parsing-no-ask-password.patch: accept no-ask-password in hostnamectl. - Add systemd-cgls-fix-piping-output.patch: fix piping output of systemd-cgls. - Add core-load-fragment-improve-error-message.patch: improve error message when parsing fragments. - Add fix-potential-bad-mem-access.patch: fix potential bad memory access. - Add socket-improve-error-message.patch: improve error message in socket handling. - Add journal-send-always-send-syslog_identifier.patch: always send syslog_identifier if available for journal. - Add crypsetup-handle-nofail.patch: handle nofail in cryptsetup. - Add crypsetup-generator-state-file-name-in-error-message.patch: add filename in error message from crypsetup-generator. - Add fstab-generator-error-message-on-duplicates.patch: improve error message on duplicate in fstab-generator. - Add systemctl-verbose-message-on-missing-install.patch: reword missing install error message in systemctl. - Add shutdown-improvements.patch: various improvements at shutdown. - Add localectl-fix-assertion.patch: fix assertion in localectl. - Add path-util-fix-potential-crash.patch: fix potential crash in path-util. - Add coredumpctl-fix-crash.patch: fix crash in coredumpctl. - Add socket-verbose-error-message.patch: add more verbose error message in socket handling. - Add pam-properly-handle-ssh-logins-without-pam-tty-field.patch: handle properly ssh-logins without pam tty field. - Add fstab-generator-properly-detect-bind-mounts.patch: properly detect bind-mounts in fstab-generator. - Add localectl-support-systems-without-locale-archive.patch: localectl now supports systemd without locale-archive file. - Add logind-capability-making-seats-without-fb.patch: allows capability of making seats without fb. - Add service-forking-ignore-exit-status-main-process.patch: ignore exit-statis of main process when forking, if specified in unit file. - Add systemctl-no-assert-on-reboot-without-dbus.patch: don't assert on reboot if dbus isn't there. - Add logind-ignore-non-tty-non-x11-session-on-shutdown.patch: ignore non tty non-x11 session on shutdown. - Add journalctl-quit-on-io-error.patch: fix journalctl quit on io error. - Add do-not-make-sockets-dependent-on-lo.patch: do not make sockets dependent on lo interface. - Add shutdown-dont-force-mnt-force-on-final-umount.patch: don't force MNT_FORCE on final umount at shutdown. - Add shutdown-ignore-loop-devices-without-backing-file.patch: ignore loop devices without backing file at shutdown. - Add fix-bad-mem-access.patch: fix bad memory access - Add parse-multiline-env-file.patch: correctly parse multiline environment files (bnc#793411).- Add multiple-sulogin.patch: allows multiple sulogin instance (bnc#793182).- udev: path_id - handle Hyper-V devices add: 1008-udev-path_id-handle-Hyper-V-devices.patch - keymap: Update the list of Samsung Series 9 models add: 1009-keymap-Update-the-list-of-Samsung-Series-9-models.patch - keymap: Add Samsung 700T add: 1010-keymap-Add-Samsung-700T.patch - libudev: avoid leak during realloc failure add: 1011-libudev-avoid-leak-during-realloc-failure.patch - libudev: do not resolve $attr{device} symlinks add: 1012-libudev-do-not-resolve-attr-device-symlinks.patch - libudev: validate 'udev' argument to udev_enumerate_new() add: 1013-libudev-validate-udev-argument-to-udev_enumerate_new.patch - udev: fix whitespace add: 1014-udev-fix-whitespace.patch - udev: properly handle symlink removal by 'change' event add: 1015-udev-properly-handle-symlink-removal-by-change-event.patch - udev: builtin - do not fail builtin initialization if one of them returns an error add: 1016-udev-builtin-do-not-fail-builtin-initialization-if-o.patch - udev: use usec_t and now() add: 1017-udev-use-usec_t-and-now.patch- udevd: add missing ':' to getopt_long 'e'. add: 1007-udevd-add-missing-to-getopt_long-e.patch - clean up systemd.spec, make it easy to see which are udev and systemd patches. - make 'reload' and 'force-reload' LSB compliant (bnc#793936).- detect-btrfs-ssd.patch: Fix btrfs detection on SSD. - timedated-donot-close-bogus-dbus-connection.patch: Avoid closing an non-existent dbus connection and getting assertion failures.- add conflicts between udev-mini and udev-mini-devel to libudev1- revert-of-9279749b84cc87c7830280b7895a48bed03c9429.patch: do not consider failure to umount / and /usr an error.- Add fix-devname-prefix.patch: fix modules.devname path, it isn't in /usr. - Move post script to fix symlinks in /etc/systemd/system to a trigger to run it after old systemd is uninstalled.- Add fix-debugshell.patch: use /bin/bash if sushell isn't installed (bnc#789052). - Add handle-root-uses-lang.patch: handle ROOT_USES_LANG=ctype (bnc#792182). - Ensure libudev1 and libudev-mini1 conflicts.- Fix creation of /dev/root link.- Add remount-ro-before-unmount.patch: always remount read-only before unmounting in final shutdown loop. - Add switch-root-try-pivot-root.patch: try pivot_root before overmounting /- links more manpages for migrated tools (from Christopher Yeleighton). - disable boot.localnet service, ypbind service will do the right thing now (bnc#716746) - add xdm-display-manager.patch: pull xdm.service instead of display-manager.service (needed until xdm initscript is migrated to native systemd service). - Add fix-permissions-btmp.patch: ensure btmp is owned only by root (bnc#777405). - Have the udev package create a tape group, as referenced by 50-udev-default.rules and 60-persistent-storage-tape.rules (DimStar). - Add fix-bad-memory-access.patch: fix crash in journal rotation. - Add fix-dbus-crash.patch: fix D-Bus caused crash. - Add sync-on-shutdown.patch: ensure sync is done when initiating shutdown. - Add mount-efivars.patch: mount efivars if booting on UEFI.- Ship a empty systemd-journald initscript in systemd-logger to stop insserv to complain about missing syslog dependency. - Update 0001-service-Fix-dependencies-added-when-parsing-insserv..patch with bug fixes from Debian.- /var/log/journal is now only provided by systemd-logger (journal won't be persistent for people using another syslog implementation). - install README in /var/log (in systemd-logger) and /etc/init.d - create adm group when installing systemd. - fix path in udev-root-symlink.systemd. - Enforce Requires(post) dependency on libudev in main systemd package (help upgrade). - Ensure configuration is reloaded when upgrading and save random seed when installing. - Create /lib/udev symlink, if we do a fresh install. - Add fix-build-glibc217.patch: fix build with latest glibc. - Add libgcrypt.m4: copy of autoconf macro from libgcrypt, only used to bootstrap systemd-mini.- adding a package systemd-logger that blocks syslog implementations from installation to make an installation that only uses the journal- Don't hardcode path for systemctl in udev post script. - Ensure systemd-udevd.service is shadowing boot.udev when booting under systemd. - Fix udev daemon upgrade under both systemd and sysvinit. - Add fix-logind-pty-seat.patch: fix logind complaining when doing su/sudo in X terminal.- add libudev1 to baselibs.conf- udev is GPL-2.0, the rest remains LGPL-2.1+ (bnc#787824)- Add var-run-lock.patch: make sure /var/run and /var/lock are handled as bind mount if they aren't symlinks. - Update storage-after-cryptsetup.patch with new systemctl path. - Migrate broken symlinks in /etc/systemd/system due to new systemd location.- Update to release 195: + journalctl agained --since and --until, as well as filtering for units with --unit=/-u. + allow ExecReload properly for Type=oneshot (needed for iptables.service, rpc-nfsd.service). + journal daemon supports time-based rotation and vaccuming. + journalctl -F allow to list all values of a certain field in journal database. + new commandline clients for timedated, locald and hostnamed + new tool systemd-coredumpctl to list and extract coredumps from journal. + improve gatewayd: follow mode, filtering, support for HTML5/JSON Server-Sent-Events. + reload support in SysV initscripts is now detected when file is parted. + "systemctl status --follow" as been removed, use "journalctl -fu instead" + journald.conf RuntimeMinSize and PersistentMinSize settings have been removed. - Add compatibility symlink for systemd-ask-password and systemctl in /bin.- Create and own more systemd drop-in directories.- Improve mini packages for bootstrapping. - do not mount /tmp as tmpfs by default.- Fix install script when there is no inittab- Create a systemd-mini specfile to prevent cycle in bootstrapping- udev and its subpackages are now generated by systemd source package. - migrate udev and systemd to /usr - Update to version 194: + if /etc/vconsole.conf is non-existent or empty and if /etc/sysconfig/console:CONSOLE_FONT (resp /etc/sysconfig/keyboard:KEYTABLE) set, console font (resp keymap) is not modified. - Changes from version 44 to 193: + journalctl gained --cursor= to show entries starting from a specified location in journal. + Size limit enforced to 4K for fields exported with "-o json" in journalctl. Use --all to disable this behavior. + Optional journal gateway daemon (systemd-journal-gatewayd.service) to access journal via HTTP and JSON. Use "wget http://localhost:19531/entries" to get /var/log/messages compatible format and 'curl -H"Accept: application/json" http://localhost:19531/entries' for JSON formatted content. HTML5 static page is also available as explained on http://0pointer.de/public/journal-gatewayd + do not mount cpuset controler, doesn't work well by default ATM. + improved nspawn behaviour with /etc/localtime + journald logs its maximize size on disk + multi-seat X wrapper (partially merged in upstream X server). + HandleSleepKey has been splitted into HandleSuspendKey and HandleHibernateKey. + systemd and logind now handle system sleep states, in particular suspending and hibernating. + new cgroups are mounted by default (cpu, cpuacct, net_cls, net_pri) + sync at shutdown is now handled by kernel + imported journalctl output (colors, filtering, pager, bash completion). + suffix ".service" may now be ommited on most systemctl command involving service unit names. + much improved nspawn containers support. + new conditions added : ConditionFileNotEmpty, ConditionHost, ConditionPathIsReadWrite + tmpfiles "w" supports file globbing + logind handles lid switch, power and sleep keys all the time, unless systemd-inhibit - -what=handle-power-key:handle-sleep-key:handle-lid-switch is run by Desktop Environments. + support for reading structured kernel message is used by default (need kernel >= 3.5). /proc/kmsg is now used only by classic syslog daemons. + Forward Secure Sealing is now support for Journal files. + RestartPrevenExitStatus and SuccessExitStatus allow configure of exit status (exit code or signal). + handles keyfile-size and keyfile-offset in /etc/crypttab. + TimeoutSec settings has been splitted into TimeoutStartSec and TimeoutStopSec. + add SystemCallFilters option to add blacklist/whitelist to system calls, using SECCOMP mode 2 of kernel >= 3.5. + systemctl udevadm info now takes a /dev or /sys path as argument: - udevadm info /dev/sda + XDG_RUNTIME_DIR now uses numeric UIDs instead of usernames. + systemd-loginctl and systemd-journalctl have been renamed to loginctl and journalctl to match systemctl. + udev: RUN+="socket:..." and udev_monitor_new_from_socket() is no longer supported. udev_monitor_new_from_netlink() needs to be used to subscribe to events. + udev: when udevd is started by systemd, processes which are left behind by forking them off of udev rules, are unconditionally cleaned up and killed now after the event handling has finished. Services or daemons must be started as systemd services. Services can be pulled-in by udev to get started, but they can no longer be directly forked by udev rules. + For almost all files, license is now LGPL2.1+ (from previous GPL2.0+). Exception are some minor stuff in udev (will be changed to LGPL2.1 eventually) and MIT license sd-daemon.[ch] library. + var-run.mount and var-lock.mount are no longer provided (should be converted to symlinks). + A new service type Type=idle to avoid ugly interleaving of getty output and boot status messages. + systemd-delta has been added, a tool to explore differences between user/admin configuration and vendor defaults. + /tmp mouted as tmpfs by default. + /media is now longer mounted as tmpfs + GTK tool has been split off to systemd-ui package. + much improved documentation. - Merge BuildRequires from udev package: gobject-introspection-devel, gtk-doc, libsepol-devel, libusb-devel, pkgconfig(blkid), pkgconfig-glib-2.0), pjgconfig(libcryptsetup), pkgconfig(libpci), pkgconfig(libqrencode), pkgconfig(libselinux), pkgconfig(usbutils). - Add pkgconfig(libqrencode) and pkgconfig(libmicrohttpd) - Merge sources from udev package: boot.udev, write_dev_root.rules, udev-root-symlink.systemd. - Merge patches from udev package: numbered started from 1000): 0001-Reinstate-TIMEOUT-handling.patch, 0013-re-enable-by_path-links-for-ata-devices.patch, 0014-rules-create-by-id-scsi-links-for-ATA-devices.patch, 0026-udev-netlink-null-rules.patch, 0027-udev-fix-sg-autoload-regression.patch. - Remove following patches, merged upstream: 0001-util-never-follow-symlinks-in-rm_rf_children.patch, fixppc.patch, logind-logout.patch, fix-getty-isolate.patch, fix-swap-priority.patch, improve-restart-behaviour.patch, fix-dir-noatime-tmpfiles.patch, journal-bugfixes.patch, ulimit-support.patch, change-terminal.patch, fix-tty-startup.patch, fix-write-user-state-file.patch, fix-analyze-exception.patch, use_localtime.patch, journalctl-pager-improvement.patch, avoid-random-seed-cycle.patch, 0001-add-sparse-support-to-detect-endianness-bug.patch, drop-timezone.patch. - Rebase the following patches: 0001-Add-bootsplash-handling-for-password-dialogs.patch, 0001-handle-disable_caplock-and-compose_table-and-kbd_rat.patch, 0001-service-Fix-dependencies-added-when-parsing-insserv..patch, 0001-service-flags-sysv-service-with-detected-pid-as-Rema.patch, crypt-loop-file.patch, delay-fsck-cryptsetup-after-md-lvm-dmraid.patch, dm-lvm-after-local-fs-pre-target.patch, fastboot-forcefsck.patch, fix-enable-disable-boot-initscript.patch, modules_on_boot.patch, new-lsb-headers.patch, storage-after-cryptsetup.patch, support-suse-clock-sysconfig.patch, support-sysvinit.patch, sysctl-modules.patch, systemd-numlock-suse.patch, tty1.patch.- Add use_localtime.patch: use /etc/localtime instead of /etc/timezone (bnc#773491) - Add support-suse-clock-sysconfig.patch: read SUSE /etc/sysconfig/clock file. - Add drop-timezone.patch: drop support for /etc/timezone, never supported on openSUSE. - Add journalctl-pager-improvement.patch: better handle output when using pager. - Add fix-enable-disable-boot-initscript.patch: support boot.* initscripts for systemctl enable /disable (bnc#746506).- Ensure systemd macros never fails (if systemd isn't install)- Add fix-analyze-exception.patch: prevent exception if running systemd-analyze before boot is complete (bnc#772506)- Fix NumLock detection/set race condition (bnc#746595#c47).- Move systemd-analyse to a subpackage, to remove any python dependencies from systemd main package (bnc#772039).- Add fastboot-forcefsck.patch: ensure fastboot and forcefsck on kernel commandline are handled. - Add fix-write-user-state-file.patch: write logind state file correctly. - Disable logind-logout.patch: cause too many issues (bnc#769531).- Add fix-tty-startup.patch: don't limit tty VT to 12 (bnc#770182).- Fix SUSE specific sysconfig numlock logic for 12.2 (bnc#746595).- Add fix-dir-noatime-tmpfiles.patch: do not modify directory atime, which was preventing removing empty directories (bnc#751253, rh#810257). - Add improve-restart-behaviour.patch: prevent deadlock during try-restart (bnc#743218). - Add journal-bugfixes.patch: don't crash when rotating journal (bnc#768953) and prevent memleak at rotation time too. - Add ulimit-support.patch: add support for system wide ulimit (bnc#744818). - Add change-terminal.patch: use vt102 instead of vt100 as terminal for non-vc tty. - Package various .wants directories, which were no longer packaged due to plymouth units being removed from systemd package. - Fix buildrequires for manpages build.- Do not ship plymouth units, they are shipped by plymouth package now (bnc#769397). - Fix module loading (bnc#769462)- Add fix-swap-priority: fix default swap priority (bnc#731601).- Re-enable logind-logout.patch, fix in xdm-np PAM file is the real fix.- Update new-lsb-headers.patch to handle entries written after description tag (bnc#727771, bnc#747931).- Disable logind-logout.patch: it crashes sudo session (if called after su -l) (bnc#746704).- Add fix-getty-isolate.patch: don't quit getty when changing runlevel (bnc#746594)- Implemented SUSE specific sysconfig numlock logic (bnc#746595).- Add dbus-1 as BuildRequires to fix build.- apply ppc patch to systemd-gtk too (fixes build)- Update fixppc.patch with upstream patches - Add comments from upstream in 0001-util-never-follow-symlinks-in-rm_rf_children.patch. - Add logind-logout.patch: it should fix sudo / su with pam_systemd (bnc#746704).- Add 0001-add-sparse-support-to-detect-endianness-bug.patch: fix endianness error, preventing journal to work properly on ppc. - Add fixppc.patch: fix build and warnings on ppc.- Add 0001-util-never-follow-symlinks-in-rm_rf_children.patch: fix CVE-2012-1174 (bnc#752281).- Update to version 43: + Support optional initialization of the machine ID from the KVM or container configured UUID. + Support immediate reboots with "systemctl reboot -ff" + Show /etc/os-release data in systemd-analyze output + Many bugfixes for the journal, including endianess fixes and ensuring that disk space enforcement works + non-UTF8 strings are refused if used in configuration and unit files. + Register Mimo USB Screens as suitable for automatic seat configuration + Reorder configuration file lookup order. /etc now always overrides /run. + manpages for journal utilities. - Drop fix-c++-compat.patch, no-tmpfs-fsck.patch, systemd-journald-fix-endianess-bug.patch. - Requires util-linux >= 2.21 (needed to fix fsck on tmpfs).- Add fix-c++-compat.patch: fix C++ compatibility error in header.- Add systemd-journald-fix-endianess-bug.patch: fix journald not starting on ppc architecture. - Add correct_plymouth_paths_and_conflicts.patch: ensure plymouth is correctly called and conflicts with bootsplash.- Remove rsyslog listen.conf, handled directly by rsyslog now (bnc#747871).- Update to version 43: + requires /etc/os-release, support for /etc/SuSE-release is no longer present. + Track class of PAM logins to distinguish greeters from normal user logins. + Various bug fixes.- Use pkgconfig symbols for BuildRequires and specify version- Enable Plymouth integration. * Bootsplash related files will be moved to the bootsplash package- Update to version 42: + Various bug fixes + Watchdog support for supervising services is now usable + Service start rate limiting is now configurable and can be turned off per service. + New CanReboot(), CanPowerOff() bus calls in systemd-logind - Dropped fix-kmod-build.patch, fix-message-after-chkconfig.patch, is-enabled-non-existing-service.patch (merged upstream) - Add libxslt1 / docbook-xsl-stylesheets as BuildRequires for manpage generation- Update to version 41: + systemd binary is now installed in /lib/systemd (symlink for /bin/systemd is available now) + kernel modules are now loaded through libkmod + Watchdog support is now useful (not complete) + new kernel command line available to set system wide environment variable: systemd.setenv + journald capabilities set is now limited + SIGPIPE is ignored by default. This can be disabled with IgnoreSIGPIPE=no in unit files. - Add fix-kmod-build.patch: fix build with libkmod - Drop remote-fs-after-network.patch (merged upstream) - Add dm-lvm-after-local-fs-pre-target.patch: ensure md / lvm /dmraid is started before mounting partitions, if fsck was disabled for them (bnc#733283). - Update lsb-header patch to correctly disable heuristic if X-Systemd-RemainAfterExit is specified (whatever its value) - Add fix-message-after-chkconfig.patch: don't complain if only sysv services are called in systemctl. - Add is-enabled-non-existing-service.patch: fix error message when running is-enabled on non-existing service.- Update to version 40: + reason why a service failed is now exposed in the"Result" D-Bus property. + Rudimentary service watchdog support (not complete) + Improve bootcharts, by immediatly changing argv[0] after forking to to reflect which process will be executed. + Various bug fixes. - Add remote-fs-after-network.patch and update insserv patch: ensure remote-fs-pre.target is enabled and started before network mount points (bnc#744293). - Ensure journald doesn't prevent syslogs to read from /proc/kmsg.- Ensure systemd show service status when started behind bootsplash (bnc#736225). - Disable core dump redirection to journal, not stable atm.- Update modules_on_boot.patch to not cause failed state for systemd-modules-load.service (bnc#741481).- Update to version 39: + New systemd-cgtop tool to show control groups by their resource usage. + Linking against libacl for ACLs is optional again. + If a group "adm" exists, journal files are automatically owned by them, thus allow members of this group full access to the system journal as well as all user journals. + The journal now stores the SELinux context of the logging client for all entries. + Add C++ inclusion guards to all public headers. + New output mode "cat" in the journal to print only text messages, without any meta data like date or time. + Include tiny X server wrapper as a temporary stop-gap to teach XOrg udev display enumeration (until XOrg supports udev hotplugging for display devices). + Add new systemd-cat tool for executing arbitrary programs with STDERR/STDOUT connected to the journal. Can also act as BSD logger replacement, and does so by default. + Optionally store all locally generated coredumps in the journal along with meta data. + systemd-tmpfiles learnt four new commands: n, L, c, b, for writing short strings to files (for usage for /sys), and for creating symlinks, character and block device nodes. + New unit file option ControlGroupPersistent= to make cgroups persistent. + Support multiple local RTCs in a sane way. + No longer monopolize IO when replaying readahead data on rotating disks. + Don't show kernel threads in systemd-cgls anymore, unless requested with new -k switch. - Drop systemd-syslog_away_early_on_shutdown.patch: fixed upstream. - Add fdupes to BuildRequires and use it at build time.- Make the systemd journal persistent by creating the /var/log/journal directory- Update to version 38 : - Bugfixes - Implementation of a Journal Utility Library - Implementation of a 128 Bit ID Utility Library - 11 Patches integrated upstream - Add systemd-syslog_away_early_on_shutdown.patch: make sure syslog socket goes away early during shutdown. - Add listen.conf for rsyslog. This will ensure that it will still work fine with rsyslog and the new journal.- Add fix-is-enabled.patch: ensure systemctl is-enabled work properly when systemd isn't running. - Add logind-console.patch: do not bail logind if /dev/tty0 doesn't exist (bnc#733022, bnc#735047). - Add sysctl-modules.patch: ensure sysctl is started after modules are loaded (bnc#725412). - Fix warning in insserv patch. - Update avoid-random-seed-cycle.patch with better upstream approach. - Update storage-after-cryptsetup.patch to restart lvm before local-fs.target, not after it (bnc#740106). - Increase pam-config dependency (bnc#713319).- Remove storage-after-cryptsetup.service, add storage-after-cryptsetup.patch instead to prevent dependency cycle (bnc#722539). - Add delay-fsck-cryptsetup-after-md-lvm-dmraid.patch: ensure fsck/cryptsetup is run after lvm/md/dmraid have landed (bnc#724912). - Add cron-tty-pam.patch: Fix cron filling logs (bnc#731358). - Add do_not_warn_pidfile.patch: Fix PID warning in logs (bnc#732912). - Add mount-swap-log.patch: Ensure swap and mount output is redirected to default log target (rhb#750032). - Add color-on-boot.patch: ensure colored status are displayed at boot time. - Update modules_on_boot.patch to fix bnc#732041. - Replace private_tmp_crash.patch with log_on_close.patch, better upstream fix for bnc#699829 and fix bnc#731719. - Update vconsole patch to fix memleaks and crash (bnc#734527). - Add handle-racy-daemon.patch: fix warnings with sendmail (bnc#732912). - Add new-lsb-headers.patch: support PIDFile: and X-Systemd-RemainAfterExit: header in initscript (bnc#727771). - Update bootsplash services to not start if vga= is missing from cmdline (bnc#727771) - Add lock-opensuse.patch: disable /var/lock/{subsys,lockdev} and change default permissions on /var/lock (bnc#733523). - Add garbage_collect_units: ensure error units are correctly garbage collected (rhb#680122). - Add crypt-loop-file.patch: add support for crypt file loop (bnc#730496).- add libtool as buildrequire to avoid implicit dependency- Fix rpm macros to only call presets on initial install (bnc#728104).- Add no-tmpfs-fsck.patch: don't try to fsck tmpfs mountpoint (bnc#726791).- Add avoid-random-seed-cycle.patch: fix dependency cycle between cryptsetup and random-seed-load (bnc#721666). - Add crash-isolating.patch: fix crash when isolating a service. - Fix bootsplash being killed too early. - Fix some manpages not being redirected properly. - Add storage-after-cryptsetup.service to restart lvm after cryptsetup. Fixes lvm on top of LUKS (bnc#724238).- Recommends dbus-1-python, do not requires python (bnc#716939) - Add private_tmp_crash.patch: prevent crash in debug mode (bnc#699829). - Add systemctl-completion-fix.patch: fix incorrect bash completion with some commands (git).- Shadow single sysv service, it was breaking runlevel 1. - Add modules_on_boot.patch to handle /etc/sysconfig/kernel MODULES_ON_BOOT variable (bnc#721662).- Update to release 37: - many bugfixes - ConditionCapability added, useful for containers. - locale mechanism got extend to kbd configuration for both X and the console - don't try to guess PID for SysV services anymore (bnc#723194) - Drop detect-non-running.patch, logind-warning.patch. - Rewrite systemd-sysv-convert in bash (bnc#716939)- make sure updaters get in the /sbin/init from here - the sub package of the split package will decide which init wins in update case- under openSUSE if it's not systemd, chances are good it's sysvinit- do not list specific sbin_init providers- Add logind-warning.patch: fix pam warning (bnc#716384)- Update to version 36 : - many bugfixes - systemd now requires socket-activated syslog implementations - After=syslog.target is no longer needed in .service files - X-Interactive is ignored in LSB headers (was not working) - Enable back insserv.conf parsing in systemd core and fix added dependencies (bnc#721428). - Fix detection of LSB services status when running daemon (bnc#721426). - Drop 0001-execute-fix-bus-serialization-for-commands.patch, fix-reload.patch- Add services to stop bootsplash at end of startup and start it at beginning of shutdown. - Fix bootsplash call and ensure dependencies are set right.- Add detect-non-running.patch: fix assertion when running systemctl under non systemd system (git). - Requires presets branding package. - Improve macros a little bit.- Merge migration rpm macros into service_add/service_del macros. - Use systemd presets in rpm macros - Add fix-reload.patch: handle daemon-reload and start condition properly (bnc#719221).- Add systemd-splash / bootsplash-startup.service: enable bootsplash at startup.- Create -32bit package (bnc#713319)- Do not mask localnet service, it is not yet handled by systemd. (bnc#716746)- Add revert_insserv_conf_parsing.patch and systemd-insserv_conf: remove insserv.conf parsing from systemd and use generator instead. - put back default.target creation at package install and remove inittab generator, Yast2 is now able to create it.- Update to version 34: * Bugfixes * optionaly apply cgroup attributes to cgroups systemd creates * honour sticky bit when trimming cgroup trees * improve readahead - Add libacl-devel as BuildRequires (needed for systemd-uaccess) - Add some %{nil} to systemd.macros to fix some build issues. - Fix dbus assertion - move gtk part to its own package, to reduce bootstrapping (bnc#713981).- Update compose_table patch to use two separate loadkeys call, compose table overflows otherwise (spotted by Werner Fink).- Add tty1.patch: ensure passphrase are handled before starting gettty on tty1. - Add inittab generator, creating default.target at startup based on /etc/inittab value. - No longer try to create /etc/systemd/system/default.target at initial package install (bnc#707418) - Fix configuration path used for systemd user manager. - Ensure pam-config output is no display in install script. - Remove buildrequires on vala, no longer needed.- Handle disable_capslock, compose table and kbd_rate - Add rpm macros.systemd file. - Do not disable klogd, it has its own service now. - Handle kexec correctly (bnc#671673). - Disable preload services, they are conflicting with systemd.- enable pam_systemd module, using pam-config.- Fix crash with systemctl enable.- Fix localfs.service to no cause cycle and starts it after local-fs.target.- Remove root-fsck.patch, mkinitrd will use the same path as dracut. - Add systemd-cryptsetup.patch: don't complain on "none" option in crypttab. - Add systemd-cryptsetup-query.patch: block boot until passphrase is typed.- Add root-fsck.patch: do not run fsck on / if it is rw - Ship a non null localfs.service, fixes static mount points not being mounted properly.- Update to version 33: * optimizations and bugfixes. * New PrivateNetwork= service setting which allows you to shut off networking for a specific service (i.e. all routable network interfaces will disappear for that service). * Merged insserv-parsing.patch and bash-completion-restart.patch patches.- Add insserv-parsing.patch: read/parse insserv.conf. - Add bash-completion-restart.patch: fix restart service list (bnc#704782).- Split up devel package. - restart logind after upgrade. - Adjust rpmlintrc for changes.- Update to version 32: * bugfixes * improve selinux setup- Update to version 31: * rewrite of enable/disable code: New features systemctl --runtime, systemctl mask, systemctl link and presets. * sd-daemon is now shared library.- Update to version 30: + Logic from pam_systemd has been moved to new systemd-login. + VT gettys are autospawn only when needed + Handle boot.local/halt.local on SUSE distribution + add support for systemctl --root- Make sure to not start kbd initscript, it is handled by systemd natively.- version 29: + enable chkconfig support in systemctl for openSUSE. + systemctl: plug a leak upon create_symlink mismatch + mount /run without MS_NOEXEC + dbus: fix name of capability property + systemctl: fix double unref of a dbus message + cryptsetup-generator: fix /etc/cryptsetup options + selinux: selinuxfs can be mounted on /sys/fs/selinux + readahead-common: fix total memory size detection + systemctl: fix 'is-enabled' for native units under /lib + systemctl: fix a FILE* leak + pam-module: add debug= parameter + remote-fs.target: do not order after network.target - update tarball url.- Use RPM macros instead of $RPM_FOO variables - Don't require %{version}-%{release} of the base package, %{version} is sufficient- new snapshot - mount /run without MS_NOEXEC - readahead-common: fix total memory size detection - enable chkconfig support in systemctl for openSUSE - selinux: selinuxfs can be mounted on /sys/fs/selinux - cryptsetup-generator: fix /etc/cryptsetup options - systemctl: fix double unref of a dbus message - drop merged chkconfig patch- Add sysv chkconfig patch to be able to enable / disable sysv initscripts with systemctl. - Ensure plymouth support is buildable conditionnally.- version 28 - drop hwclock-save.service - fix segfault when a DBus message has no interface - man: update the list of unit search locations - readahead-collect: ignore EACCES for fanotify - rtc in localtime: use settimeofday(NULL, tz) instead of hwclock(8)- new snapshot - fix crash in D-Bus code- new snapshot - socket: always use SO_{RCV,SND}BUFFORCE to allow larger values - util: use new VT ESC sequence to clear scrollback buffer - sd-daemon: move _sd_hidden_ from .h to .c file - missing: add IP_TRANSPARENT- version 27 - util: use open_terminal() in chvt() too - socket: expose SO_BROADCAST - git: add .mailmap - exec: expose tty reset options in dbus introspection data - socket: expose IP_TRANSPARENT - exec: hangup/reset/deallocate VTs in gettys - socket: use 666 socket mode by default since neither fifos, nor sockets, nor mqueues need to be executable - socket: add POSIX mqueue support - README: document relation to nss-myhostname - hostnamed: check that nss-myhostname is installed- new snapshot - sysctl: apply /etc/sysctl.conf last - systemd-analyze: print hostname, kernelversion and arch at the top of the plot - pam: downgrade a few log msgs - hostnamed: SetPrettyHostname() should check PK action org.freedesktop.hostname1.set-static-hostname - user-sessions: ignore EROFS when unlinking /etc/nologin if the file doesn't exist anyway - unit: make ignoring in snapshots a per unit property, instead of a per unit type property - vconsole: use open_terminal() instead of open() - units: enable automount units only if the kernel supports them- remove policy filter- add missing buildrequires dbus-1-devel, vala, libxslt-devel - touch vala files for rebuilding to unbreak Factory- also delete plymouth files- disable plymouth sub-package until plymouth gets into Factory- new snapshot - binfmt, modules-load, sysctl, tmpfiles: add missing ConditionDirectoryNotEmpty= - binfmt, modules-load, sysctl, tmpfiles: read /usr/local/lib and where appropriate /lib directories- version 26 - plymouth: introduce plymouth.enable=0 kernel command line - util: don't AND cx with cx - man: typo in sd_daemon reference - util: conf_files_list() return list as parameter - dbus: make daemon reexecution synchronous- new snapshot - service: properly notice when services with a main process that isn't a child of init die - unit: fix assert when trying to load unit instances for uninstanciable types - def: lower default timeout to 90s - manager: fix serialization counter- new snapshot - dbus: don't hit assert when dumping properties - cryptsetup: fix keyfile size option processing - socket: improve warning message when we get POLLHUP - mount: failure to mount cgroup hierarchies should not be fatal - configure: add AC_SYS_LARGEFILE- new snapshot - tmpfiles.d: switch to stacked config dirs in /lib, /etc, /run - sysctl.d, binfmt.d, modules-load.d: switch to stacked config dirs in /lib, /etc, /run - manager: mkdir /run/systemd/system when starting up - man: Spelling fixes- version 25 - mount: Allow creating mount units for /var/lib/nfs/rpc_pipefs and /proc/fs/nfsd. - socket: support ListeSpecial= sockets - vconsole: don't set console font/keymap if settings are empty - nspawn: don't fail when we receive SIGCHLD - cgroup: don't accidentaly trim on reload - units: set capability bounding set for syslog services - socket: log more information about invalid poll events - man: fix specification of default timeouts - mount,crypto: rework meaning of noauto/nofail - fsck: don't fsck against basic.target in order to properly allow automount /home - manager: when running in test mode, do not write generated unit files to /run/systemd/generator - mount: properly parse timeouts options in the middle of the string - hostnamed: drop all caps but CAP_SYS_ADMIN - execute: when we run as PID 1 the kernel doesn't give us CAP_SETPCAP by default. Get that temporarily when dropping capabilities for good - mount: make device timeout configurable - cryptsetup: do not order crypto DM devices against the cryptsetup service - socket: reuse existing FIFOs - socket: guarantee order in which sockets are passed to be the one of the configuration file - systemctl: always consider unit files with no [Install] section but stored in /lib enabled - job: also print status messages when we successfully started a unit - hostnamed: add reference to SMBIOS specs - man: runlevel 5 is usually more comprehensive, so use it instead of 3 to detect whether a sysv service is enabled - polkit: follow the usual syntax for polkit actions - hostnamed: introduce systemd-hostnamed - units: order quotacheck after remount-rootfs - hostname: split out hostname validation into util.c - dbus: split out object management code into dbus-common, and simplify it - strv: properly override settings in env_append() - strv: detect non-assignments in env blocks properly in env_append() - strv: handle empty lists in strv_copy() properly - util: truncate newline inside of read_one_line_file() - util: modernize get_parent_of_pid() a bit - crypto: let the cryptsetup binary handles its own configurable timeouts - logger,initctl: use global exit timeout - ask-password: use default timeout - manager: drop all pending jobs when isolating - manager: introduce IgnoreOnIsolate flag so that we can keep systemd-logger around when isolating - units: never pull in sysinit from utmp, so that we can shutdown from emergency mode without pulling in sysinit - manager: downgrade a few log messages - units: require syslog.socket from the logger because we simply fail if we don't have it - logger: adjust socket description to match service - units: set stdout of kmsg syslogd to /dev/null - units: add --no-block when starting normal service after shell exited - ask-password: use kill(PID, 0) before querying a password - ask-password: support passwords without timeouts - ask-password: always send final NUL char - ask-password: properly accept empty passwords from agent - unit: skip default cgroup setup if we have no hierarchy - units: isolate emergency.target instead of emergency.service when we fail to mount all file systems - mount: don't pull in stdio logger for root mount unit - cgroup: be nice to Ingo Molnar - pam: use /proc/self/sessionid only with CAP_AUDIT_CONTROL - pam: use /proc/self/loginuid only with CAP_AUDIT_CONTROL - socket: try creating a socket under our own identity if we have no perms to consult the selinux database - socket: fix check for SEQPACKET - execute: don't fail if we cannot fix OOM in a container - unit: fix dump output - socket: be a bit more verbose when refusing to start a socket unit - socket: support netlink sockets - local-fs: invoke emergency.service mounting at boot fails - path: optionally, create watched directories in .path units - tmpfiles: don't warn if two identical lines are configured - man: add man page for ask-password - dbus: expose monotonic timestamps on the bus - manager: no need to use randomized generator dir when running as system manager - don't make up buffer sizes, use standard LINE_MAX instead - unit: disallow configuration of more than one on_failure dependencies if OnFailureIsolate= is on - unit: pull in logger unit only when running in system mode - manager: serialize/deserialize max job id and /usr taint flag - manager: don't garbage collect jobs when isolating, to change global state - unit: introduce OnFailureIsolate= - mount: relabel both before and after a mount, just in case - cmdline: we actually want to parse the kernel cmdline in VMs, just not in containers - units: rename rtc-set.target to time-sync.target and pull it in by hwclock-load.service - job: fix deserialization of jobs: do not ignore ordering - systemctl: properly parse JobNew signals - service: fix units with more than one socket - systemctl: make most operations NOPs in a chroot - manager: don't show PID for incoming signals if it is 0 - man: fix description of systemctl reload-or-try-restart - mount: block creation of mount units for API file systems - units: call the logger a bridge too - build-sys: always place user units in /usr/lib/systemd - pkgconfig: update .pc file accordingly - lookup: always also look into /usr/lib for units - exec: support unlimited resources - selinux: relabel /run the same way as /dev after loading the policy since they both come pre-filled and unlabelled - manager: fd must be int, not char - change remaining /var/run to /run - units: move user units from /usr/share to /usr/lib since they might be arch-dependent - man: document /etc/sysctl.d/ - binfmt: add binfmt tool to set up binfmt_misc at boot - tmpfiles: create leading directories for d/D instructions - condition: add ConditionSecurity - load-fragment: unify config_parse_condition_{kernel, virt} - condition: fix dumping of conditions - initctl: /dev/initctl is a named pipe, not a socket - kmsg-syslogd: pass facility value into kmsg - move /var/lock to HAVE_SYSV_COMPAT - tmpfiles: split off rules for legacy systems into legacy.conf - general: replace a few uses of /var/run by /run - tmpfiles: enforce new /var/lock semantics - man: document ConditionPathIsDirectory= - mount: also relabel pre-mounted API dirs - log: don't strip facility when writing to kmsg - build-sys: create a number of drop-in config dirs - random: do not print warning if random seed doesn't exist - plymouth: use PID file to detect whether ply is running - build-sys: install systemd-analyze by default - analyze: improve output - analyze: add plotter - unit: when deserializing do reconnect to dbus/syslog when they show up - analyze: beautify output a bit - add systemd-analyze tool - unit: don't override timestamps due to state changes when deserializing - plymouth: don't explicitly enable status message when plymouth is up - status: show status messages unconditionally if plymouth is around - taint: add missing cgroups taint flag - locale: don't access misinitialized variable - quota: do not pull in quota tools for mounts that do not originate in neither /etc/fstab nor fragment files - manager: fix taint check for /usr - unit: never apply /etc/rcN.d/ priority to native services - unit: fix parsing of condition-result - unit: don't complain about failed units when deserializing - exec: drop process group kill mode since it has little use and confuses the user - cgroup: explain when we cannot initialize the cgroup stuff - systemctl: don't truncate description when using pager - ask-password: also accept Backspace as first keypress as silent mode switch - unit: when deserializing jobs, don't pull in dependencies - locale: fix LC_MESSAGES variable name - plymouth: Remove the calls to plymouth message - udev: systemd-tag all ttys - tmpfiles fix /run/lock permissions - ask-password: use TAB to disable asterisk password echo - execute: socket isn't abstract anymore - use /run instead of /dev/.run - man: explain a couple of default dependencies - mount: pull in quota services from local mountpoints with usr/grpquota options - service: pull in sysv facility targets from the sysv units, not the other way round - units: pull in syslog.target from syslog.socket - units: don't ever pull in SysV targets from other SysV targets - units: document that some targets exists only for compat with SysV - man: document pidns containers - units: deemphesize Names= settings, and explain why nobody whould use them - units: on mandriva/fedora create single.service alias via symlink, not Names= - units: get rid of runlevel Names=, the symlinks in /lib/systemd/system are much more useful - rework syslog detection so that we need no compile-time option what the name of the syslog implementation is - man: document .requires/ directories - special: get rid of dbus.target - exec: properly apply capability bounding set, add inverted bounding sets - dbus: add service D-Bus property "Sockets" - dbus: consolidate service SysV conditionals - unit: serialize condition test results - def: centralize definition of default timeout in one place - chkconfig: check against runlevel 5 instead of 3, since it is a superset of the latter - systemctl: accept condstop as alias for stop - dbus: allow LoadUnit to unprivileged users - umount: make sure skip_ro is always correctly initialized - create /run (link it to /var/run) - refresh splash password patch - conflict with old mkinitrd version (we need /run) - conflict with old udev (we need /run)- new snapshot - man: fix systemctl try-restart description - Add Frugalware display-manager service - main: revert recognition of "b" argument - main: interpret all argv[] arguments unconditionally when run in a container - loopback: downgrade an error to warning - nspawn: bind mount /etc/localtime - nspawn: make tty code more robust against closed/reopened /dev/console - util: make touched files non-writable by default - nspawn: allocate a new pty instead of passing ours through to avoid terminal settings chaos - main: parse the whole arv[] as kernel command line - main: check if we have a valid PID before getting the name - ask-password: reset signal mask after we are done - cgroup: don't recheck all the time whether the systemd hierarchy is mounted, to make strace outputs nicer and save a few stat()s - man: document systemd-nspawn - cgls: don't strip user processes and kernel threads from default output - umount: don't try to remount bind mounts ro during shutdown - getty: move automatic serial getty logic into generator - container: skip a few things when we are run in a container such as accessing /proc/cmdline - cgls: by default start with group of PID 1 - pam: determine user cgroup tree from cgroup of PID 1 - nspawn: move container into its own name=systemd cgroup - manager: don't show kernel boot-up time for containers - manager: show who killed us - units: add console-shell.service which can be used insted of the gettys to get a shell on /dev/console- new snapshot - build-sys: move remaining tools from sbin/ to bin/ since they might eventually be useful for user execution - hostname: don't override the hostname with localhost if it is already set and /etc/hostname unset - audit: give up sending auditing messages when it failed due to EPERM - nspawn: don't require selinux on if it is compiled in - main: remove AF_UNIX sockets before binding - shutdown: print a nice message when terminating a container - nspawn: mount /selinux if needed - shutdown: just call exit() if we are in a container - umount: assume that a non-existing /dev/loop device means it is already detached - socket: use 777 as default mode for sockets - main: log to the console in a container - main: don't parse /proc/cmdline in containers - util: add detect_container() - nspawn: reset environment and load login shell - core: move abstract namespace sockets to /dev/.run - nspawn: add simple chroot(1) like tool to execute commands in a namespace container - util: return exit status in wait_for_terminate_and_warn() - util: properly identify pty devices by their major- new snapshot - polkit: autogenerate polkit policy with correct paths - systemctl: support remote and privileged systemctl access via SSH and pkexec - gnome-ask-password-agent: fix path to watch- fix broken sysctl.service linking- new snapshot - units: move the last flag files to /dev/.run - util: close all fds before freezing execution - dbus: timeout connection setup - main: properly handle -b boot option - pam: do not leak file descriptor if flock fails - disable sysv services natively provided by systemd- new snapshot - main: refuse system to be started in a chroot - main: don't check if /usr really is a mount point, since it is fine if it is passed pre-mounted to us from the initrd - condition: take a timestamp and store last result of conditions - dev: use /dev/.run/systemd as runtime directory, instead of /dev/.systemd - machine-id: move machine-id-setup to /sbin - pkconfig: export full search path as .pc variable - selinux: bump up error level when in non-enforcing mode - dbus: fix dbus assert due to uninitialized error - dbus: properly generate UnknownInterface, UnknownProperty and PropertyReadOnly errors - mount: use /dev/.run as an early boot alias for /var/run- version 20 - service: prefix description with LSB only if script has LSB header, use 'SysV:' otherwise - unit: don't accidently create ordering links to targets when default deps are off for either target and unit - mount: support less cumbersome x-systemd-xxx mount options - unit: distuingish mandatory from triggering conditions - dbus: return DBUS_ERROR_UNKNOWN_OBJECT when an object is unknown - systemctl: when forwarding is-enabled to chkconfig hardcode runlevel 3 - job: introduce new job result code 'skipped' to use when pre conditions of job did not apply - job: convert job type as early as we can, to simplify things - Keep emacs configuration in one configuration file. - syslog: make sure the kmsg bridge is always pulled in and never terminated automatically - mount: make /media a tmpfs- new snapshot - add org.freedesktop.DBus.Properies.Set method - main: introduce /etc/machine-id - systemctl: fix exit code when directing is-enabled to chkconfig - dbus: add 'Tainted' property to Manager object - dbus: expose distribution name and features on manager object as properties - man: document changed EnvironmentFile= behaviour - main: add link to wiki page with longer explanation of the /usr madness - execute: load environment files at time of execution, not when we load the service configuration - path: after installing inotify watches, recheck file again to fix race - path: don't use IN_ATTRIB on parent dirs when watching a file, since those cannot be removed without emptying the dir first anyway and we need IN_ATTRIB only to detect the link count dropping to 0 - kill: always send SIGCONT after SIGTERM - readahead: disable collector automatically on read-only media - sysctl: use scandir() instead of nftw() to guarantee systematic ordering - support DT_UNKNOWN where necessary for compat with reiserfs - systemctl: always null-terminate the password - call systemd-machine-id-setup at installation- version 19 - udev: don't ignore non-encrypted block devices with no superblock - udev: expose ttyUSB devices too - udev: mark hvc devices for exposure in systemd - cryptsetup: add a terse help - agent: don't print warnings if a password was removed or timed out - systemctl: shutdown agent explicitly so that it can reset the tty properly - never clean up a service that still has a process in it - label: udev might be making changes in /dev while we iterate through it - systemctl: properly handle job results - job: also trigger on-failure dependencies when jobs faile due to dependencies, timeout - job: when cancelling jobs, make sure to propagate this properly to depending jobs - job: start job timeout on enqueuing not when we start to process a job - unit: increase default timeout to 3min - logger: leave the logger longer around and allow it do handle more connections - dbus: pass along information why a job failed when it failed (dbus api change!) - general: unify error code we generate on timeout - units: synchronize gettys to plymouth even if plymouth is killed by gdm - job: start job timer when we begin running the job, not already when we add it to the queue of jobs - cryptsetup: try to show the mount point for a crypto disk if we can - rescue: terminate plymouth entirely when going into rescue mode - ask-password: fix handling of timeouts when waiting for password - ask-password: supported plymouth cached passwords - main: print warning if /usr is on a seperate partition - ensure we start not a single getty before plymouth is gone because we never know which ttys plymouth still controls - unit: introduce ConditionVirtualization=- new snapshot - dbus: don't rely that timer/path units have an initialized unit field (bnc#671561)- new snapshot - order network mounts after network.target (bnc#672855)- new snapshot - kmsg-syslogd: increase terminate timeout to 5min to generte less debug spew - shutdown(8) - call kexec if kexec kernel is loaded (bnc#671673) - unit: don't timeout fsck - man: fixed typo in SyslogIdentifier= - tmpfiles: never clean up block devices - main: refuse --test as root- new snapshot - units: order fsck@.service before basic.target instead of local-fs.target to relax things a little - readahead: remove misleading error messages - man: don't do more reloads than necessary in spec files - util: retry opening a TTY on EIO - util: beef up logic to find ctty name - tmpfiles: kill double slashes in unix socket names - drop vhangup patch, it is fixed in login(3) by forwarding the SIGHUP to the child process- revert back to conflicts: sysvinit- Add temporary workaround for bnc#652633, that is do a vhangup to all processes on a tty line used for a getty- version 18 - systemctl: introduce --ignore-dependencies - systemctl: introduce --failed to show only failed services - systemctl: introduce --failed to show only failed services - rescue: make 'systemctl default' fail if there is already something running when the shell exited - util: seperate welcome line from other output by empty lines - manager: don't consider transaction jobs conflicting with queued jobs redundant - udev: ignore block devices which no known contents, to avoid trying of mounts/swapons when devices aren't set up full yet - swap: handle "nofail" from fstab - mount,swap: properly add dependencies to logger if needed - service: change default std output to inherit - exec: introduce global defaults for the standard output of services - udev: use SYSTEMD_READY to mask uninitialized DM devices - fsck: output to /dev/console by default in addition to syslog - execute: optionally forward program output to /dev/console in addition to syslog/kmsg - socket: refuse socket activation for SysV services - fsck: do not fail boot if fsck returns with an error code that hasn't 2 or 6 set - shutdown: execute all binaries in /lib/systemd/system-shutdown as last step before invoking reboot() - job: make status message printing more verbose - cryptsetup: fix unit file description - tmpfiles: never delete AF_UNIX sockets that are alive - getty: don't parse console= anymore, use /sys/class/tty/console/active instead - properly resolve /dev/console if more than once console= argument was passed on the kernel command line - getty: do not auto-spawn getty's on VC ttys if console=ttyN - fsck: skip root fsck if dracut already did it - util: when determining the right TERM for /dev/console consult /sys/class/tty/console/active - pam: introduce whitelist and blacklist user list feature - systemctl: minor optimizations - systemctl: don't unnecessarily close stdin/stdout/stderr for tty agent so that locking by tty works - readahead: disable readahead in virtual machines - tmpfiles: move binary to /bin to make it publicly available - tmpfiles: take names of tmpfiles configuration files on the command line - tmpfiles: log to stderr if possible - tmpfiles: support globs - units: introduce and hook up sound.target - dbus: allow all clients access to org.freedesktop.DBus.Peer - consider udev devices with SYSTEMD_READY=0 as unplugged - systemctl: don't start agent for --user - systemctl: make sure the tty agent does not retain a copy of stdio- new snapshot - plymouth: move plymouth out of TARGET_FEDORA - build-sys: fix AC_COMPILE_IFELSE tests - build-sys: ensure selinux configure check follows logic of other optional features - build-sys: autodetect and use pkg-config for libselinux - dbus: use ControlGroup as property name to match config option - pam: optionally reset cgroup memberships for login sessions - load-fragment: properly parse Nice= value - automount: use unit_pending_inactive() where appropriate- Removed unecessary workaround for plymouth startup.- Split plymouth support into systemd-plymouth package.- new snapshot - clang: fix some issues found with clang-analyzer - gcc: make gcc shut up- version 17 - vala 0.10 seem to work fine - cryptsetup: fix ordering loop when dealing with encrypted swap devices - main: don't warn if /etc/mtab is a symlink to /proc/mounts - socket: don't crash if the .service unit for a .socket unit is not found - mount: ignore if an fsck is requested for a bind mount, so that we don't wait for the bind 'device' to show up - automount: fix segfault when shutting down - man: give an example for vconsole.conf - dbus: don't try to connect to the system bus before it is actually up - service: make chain of main commands and control commands independent of each other, so that both can be executed simultaneously and independently - service: don't allow reload operations for oneshot services - vala: convert from dbus-glib to gdbus - systemctl: highlight failed processes in systemctl status - systemctl: show process type along process exit codes - service: when reloading a service fails don't fail the entire service but just the reload job- new snapshot - shutdown: use correct kexec options - serial-getty: do not invoke /sbin/securetty; recent pam_securetty looks for console= in /proc/cmdline - systemctl: before spawning pager cache number of columns - pam: optionally keep processes of root user around - service: if a reload operation fails, don't shut down the service - execute: make sending of SIGKILL on shutdown optional - mount: do not translate uuids to lowercase - man: document missing KillSignal= and swap options - require recent util-linux - drop mtab symlink creation which is done in util-linux- version 16 - device: don't warn if we cannot bump the udev socket buffer - logger: when passing on PID info, fall back to our own if originating process is already gone - service: don't hit an assert if information in LSB headers is incorrectly formatted - execute,util: fix two small memory leaks - getty: unset locale before execution - execute: drop empty assignments from env blocks on execution but keep them around otherwise to make them visible - umount: don't try to detach the dm device the root dir is on, to minimize warning messages - locale: fix variable names - fragment: allow prefixing of the EnvironmentFile= path with - to ignore errors - util: don't pass invalid fd to fdopendir() on error to avoid corruption of errno - tmpfiles: nicer message when two or more conflicting lines are configured for the same file - fragment: properly handle quotes in assignments in EnvironmentFile= files - sysctl: don't warn if sysctls are gone - readahead: ignore if files are removed during collection or before replay - serial: use TERM=vt100 instead of TERM=vt100-nav - cryptsetup: call mkswap on dm device, not on source device - mount-setup: mount /dev/pts with mode=620,gid=5 by default and make GID overridable via configure switch - systemctl: implement auto-pager a la git - shutdown: drop redundant sync() invocation - util: invoke sync() implicitly on freeze() - tmpfiles: do no follow symlinks when cleaning up dirs- Add support for building plymouth support with openSUSE- new snapshot - pam: do not sort user sessions into their own cgroups in the 'cpu' hierarchy - mount-setup: drop noexec flag from default mount options for /dev/shm - systemd.pc: change 'session' to 'user'- new snapshot - ifdef suse-only sysv script lookup code- add bootsplash handling patch to be able to enter e.g. crypto passphrases (bnc#659885)- new snapshot - add LSB 'smtp' alias for mail-transport-agent.target- new snapshot - path: fix watching the root directory - update README- new snapshot - gnome-ask-password-agent: also support libnotify < 0.7 for now - udev: increase event buffer size - require fsck -l- version 15 - dbus: use the right data slot allocator - manager: bump up max number of units to 128K - build-sys: allow cross-compilation - revert too new libnotify code/requirement - revert fsck -l option requirement- new snapshot - units: simplify shutdown scripts - logger: fix error handling - swap: order file-based swap devices after remount-rootfs - revert too new libnotify code/requirement - revert fsck -l option requirement- new snapshot - systemctl: don't return LSB status error codes for 'show' - mount: do not try to mount disabled cgroup controllers - man: document /etc/modules-load.d/, /etc/os-release, locale.conf, /etc/vconsole.conf, /etc/hostname - units: move a couple of units from base.target to sysinit.target - man: reorder things to follow the same order everywhere - revert too new libnotify code/requirement - revert fsck -l option requirement- version 13 - cryptsetup: actually show disk name - cryptsetup: show udev device name when asking for password - sysctl: implement native tool and support /etc/sysctl.d - units: enable console ask-password agent by default - introduce /etc/os-release distro description - job: make sure we don't fail umount.target if a mount unit failed to stop - cgroup: after killing cgroup processes, ensure the group is really dead gone. wait for 3s at max - cgroup: if we couldn't remove a cgroup after killing evertyhing in it then it's fine - cryptsetup: automatically order crypt partitions before cryptsetup.target - man: trivial BindTo description fix - manager: make list of default controllers configurable - build: expose libcryptsetup dependency in build string - pam: document controllers= switch - cgroup: by default, duplicate service cgroup in the cpu hierarchy - pam: duplicate cgroup tree in the cpu hierarchy by default, optionally more - enable native crypto handling instead of boot.crypto - revert too new libnotify code/requirement - revert fsck -l option requirement- version 12 - ask-password: add --console mode to ask /dev/console - revert too new libnotify code/requirement- new snapshot - cryptsetup: reword questions a little - units: order hwclock after readahead - path: don't mention too many inotify msgs - cryptsetup: include device name in password question - cryptsetup: lock ourselves into memory as long as we deal with passwords - plymouth: use updated socket name - units: set TERM for gettys again, since they acquire a TTY - units: allow start-up of plymouth ask-password agent very early - units: enable ask-paswword .path units early enough to be useful for early mounts - units: delay getty until logins are allowed - pam: always rely on loginuid instead of uid to determine cgroup and XDG_RUNTIME_DIR name - cgroup: call root cgroup system instead of systemd-1 - exec: determine right TERM= setting based on tty name - pam: rename master user cgroup to 'master' - drop support for MANAGER_SESSION, introduce MANAGER_USER - units: use ConditionDirectoryNotEmpty= where applicable - unit: introduce ConditionDirectoryNotEmpty= - delete tmp.mount which may conflict with an unrelated fstab entry - revert too new libnotify code/requirement - disable native crypto handling- new snapshot - load-dropin: add support for .requires directories - manager: consider jobs already installed as redundant when reducing new transactions - manager: always pull 'following' units into transaction - util: always highlight distro name - units: make use of agetty mandatory - manager: don't fail transaction if adding CONFLICTED_BY job fails - job: make it possible to wait for devices to be unplugged - tmpfiles: ignore files marked with the sticky bit - cryptsetup: handle password=none properly - cryptsetup: properly parse cipher= switch - cryptsetup: support non-LUKS crypto partitions - ask-password: enable password agent - automatically start cryptsetup when looking for mount source - log: add automatic log target - cryptsetup: hook up tool with ask-password - manager: hookup generators - split mount_point_is_api() and mount_point_ignore() - replace boot.crypto job with systemd native crypto handling - enable readahead (requires 2.6.37+ kernel's fanotify to work)- new snapshot - tmpfiles: include reference to man page in tmpfiles files - vconsole: support additional keymap for toggling layouts - main: warn if /etc/mtab is not a symlink - add bash completion for systemctl --system - man: minor tmpfiles(5) updates and reindenting - main: rename process on startup to 'systemd' to avoid confusion - unit: add ConditionNull= condition - ac-power: make ac-power a proper binary that scripts can call - manager: parse RD_TIMESTAMP passed from initrd - modules-load: fix minor race - label: use internal utility functions wher epossible - cryptsetup: minimal cryptsetup unit generator - selinux: relabel /dev after loading policy - log: downgrade syslog connection failure message - service: delay automatic restart if job is pending - manager: when isolating undo all pending jobs, too - manager: only minimize impact if we are in fail mode - replace /etc/mtab with link to /proc/self/mounts- new snapshot - man/tmpfiles.d.xml: add a manpage for tmpfiles - do not overwrite other udev tags - readahead: shortcut replay if /.readahead doesn't exist- new snapshot - fsck: return SUCCESS when we skip the check - fsck: skip checking / if it is writable - units: fix variable expansion - mount: don't pull in nofail mounts by default, but use them if they are around - job: recursively fail BoundBy dependencies - fsck: fix target name to check for - units: rename fedora/single.service to rescue.service - units: introduce plymouth-start and plymouth-kexec - unit: get rid of IgnoreDependencyFailure= - use util-linux:agetty instead of mingetty - unit: replace StopRetroactively= by BindTo= dependencies - automount: show who's triggering an automount - units: run sysctl only if /etc/sysctl.conf exists - systemctl: always show what and where for mount units - shutdown: reword a few messages a little - manager: show which jobs are actually installed after a transaction - timer: when deserializing timer state stay elapsed - device: set recursive_stop=true by default - unit: suppress incorrect deserialization errors - swap: there's no reason not order swap after sysinit - socket: fix IPv6 availability detection- new snapshot - create /dev/stderr and friends early on boot - run sysv related scripts with TERM=linux - add only swaps listed in /etc/fstab automatically to swap.target - errors: refer to systemctl status when useful - swap: add default cgroup to swap exec env - readahead: bump a device's request_nr when enabling readahead - shutdown: properly handle sigtimedwait() timing out - main: fix typo in kernel cmdline parameters help - ord-tty: properly handle SIGINT/SIGTERM - systemctl: automatically spawn temporary password agent - ask-password: properly handle multiple pending passwords - ask-password: enable plymouth agent by default - ask-password: add minimal plymouth password agent- new snapshot - make sure to pass TERM=linux to all sysv scripts - don't unset HOME/TERM when run in session mode - mount: add nosuid,nodev,noexec switches to /var/lock and /var/run - tmpfiles: Don't clean /var/lock/subsys - tmpfiles: Make wtmp match utmp perms, and add btmp - umount: Make sure / is remounted ro on shutdown - unset HOME and TERM set from the kernel - activate wall agent automatically - ask-password: add basic tty agent- new snapshot - rename ask-password-agent to gnome-ask-password-agent - fsck: suppress error message if we cannot change into single user mode since - dbus: epose FsckPassNo property for service objects - man: document systemctl --force - introduce 'systemctl kill'- new snapshot - syslog: enable kmsg bridge by default - fsck: add initial version of fsck and quotacheck wrappers - tmpfiles: remove forcefsck/fastboot flag files after boot - swap: listen for POLLPRI events on /proc/swaps if availabled - tmpfiles: integrate native tmpwatch - shutdown: loop only as long as we manage to unmount/detach devices - umount: disable dm devices by devnode, not by path name - introduce final.target - replace distro-specific shutdown scripts with native services - try to get rid of DM devices - log to console by default - introduce kexec.service, kexec.target and exit.target - hook in fsck@.service instance for all mount points with passno > 0 - systemctl: warn if user enables unit with no installation instructions - dbus: add introspection to midlevel paths - look for dynamic throw-away units in /dev/.systemd/system - major rework, use /sbin/swapon for setting up swaps - introduce Restart=on-failure and Restart=on-abort - units: enable utmp for serial gettys too - rename 'banned' load state to 'masked' - optionally, create INIT_PROCESS/DEAD_PROCESS entries for a service - use systemd-native fsck/mount - use systemd-native tmpfiles.d/ instead of tmpwatchnew snapshot - fix 'systemctl enable getty@.service' - properly support 'banning' of services - handle nologin - add native reboot/shutdown implementation- version 11- new snapshot - readahead fixes- /etc/modules.d was renamed to modules-load.d - only include tmpfiles.d/*conf files- don't create sysv order deps on merged units - fix Provides: handling in LSB headers (network.target) - native (optional) readahead- Do not package man pages twice.- new snapshot - basic services are enabled by default now- new snapshot - vconsole and locale setup - hook up tmpwatch- new snapshot - add new utility to initialize the virtual console - initialize locale from /etc/locale by default - ask-password: allow services query SSL/harddisk passphrases- version 10 - logger: support SOCK_STREAM /dev/log sockets - make sure the file system is writable before we write utmp data - systemctl: use isolate when called as telinit for a runlevel - initctl: properly use isolate when activating runlevels - set HOME=/root when running shells - make sure we don't crash if there's an automount unit without mount unit - start logger only after syslog is up- version 9 - units: don't add shutdown conflicts dep to umount.target - dbus: don't send cgroup agent messages directly to system bus - dbus: don't accept activation requests anymore if we are going down anyway - systemctl: fix return value of systemctl start and friends - service: wait for process exit only if we actually killed somebody- version 8 - KERNEL 2.6.36+ REQUIRED! - mount cgroup file systems to /sys/fs/cgroup instead of /cgroup - invoke sulogin instead of /bin/sh - systemctl: show timestamps for state changes - add global configuration options for handling of auto mounts- apply /etc/fstab mount options to all api mounts - properly handle LABEL="" in fstab - do not consider LSB exit codes 5 and 6 as failure- prefix sysv job descriptions with LSB: - add native sysctl + hwclock + random seed service files - properly fallback to rescue.target if default.target is hosed - rename ValidNoProcess= to RemainAfterExit= - add systemd-modules-load tool to handle /etc/modules.d/- add support for delayed shutdown, similar to sysv in style - rename Type=finish to Type=oneshot and allow multiple ExecStart= - don't show ENOENT for non exitent configuration files - log build time features on startup - rearrange structs to make them smaller - move runlevel[2-5] links to /lib - create default.target link to /lib not /etc - handle random-seed - write utmp record before we kill all processes - create /var/lock/subsys, /var/run/utmp- add audit messages for service changes - update utmp with external program - all to refuse manual service starting/stopping- version 7 - hide output if quiet is passed on the kernel cmdline - fix auto restarting of units after a configuration reload - don't call bus_path_escape() with NULL unit name- version 6 - man page update- new snapshot - downgrade a few log messages - properly handle devices which are referenced before they exist- new snapshot - fix dependency cycle of boot.* by splitting fsck.target - sort boot.* before other sysv services from sysinint.target - start getty for serial console- add licence to subpackages- version 5 - selinux fixes - fix hanging 'reboot' started from vc- enable getty.target by default- at install, read old inittab for the defaul target/runlevel - disable services on package uninstall- version 4 - merge systemd-install into systemctl- create config files in /etc in %post - mark files in /etc as config - remove nodev from /dev/pts - add selinux support- version 4 (pre) - require newer vala - add [Install] section to getty.target and remote-fs.target - re-enable post-build check- do not add sysv services that are not enabled in /etc/rcN.d/ - allow symlinking unit files to /dev/null - remove only pam sessions we ourselves created - unit files in /etc/ always take precedence, even over link targets- fix access mode verification of FIFOs- fix default mode of /var/run and /var/lock - force /var/run and /var/lock to be on tmpfs- always enable udev and dbus until we can require systemd from packages providing systemd service files- drop systemd-units.rpm- version 3 - treat non-existing cgroups like empty ones, to deal with races - replace --running-as= by --session and --system - always allow stopping of units that failed to load- update- drop libcgroup- trim cgroups for services that are "active" but "exited" - drop /bin/init hack and require now fixed mkinitrd- fix reboot issue - fix abstract namespace name handling (needs udev update) - prefer private D-Bus socket wherever possible- D-Bus 1.3.2 support - use COLD_BOOT=1 on reboot to skip sysv boot.d/ handling- fix typo in spec file- provide /bin/init to be found by 'too simple' mkinitrd, and work around mindless relinking of relative links in the buildsystem - add rpmlintrc to silent warnings about intentional behavior- version 2- fix 'reboot -w' to skip the actual reboot - fix segfault in D-Bus code - use unique instead of multiple keys in config file - support continuation lines in config files - support multiple commands in a single key in config files - adapt log level of some messages- version 1 - default log level to INFO - show welcome message- add systemd-install --start option - add more documentation- new snapshot with extended D-Bus support- new snapshot with default unit dependency handling- new snapshot- add more documentation- new snapshot- split off systemd-units.rpm which can be pulled-in by other packages without further dependencies- add more documentation- more man pages and documentation- conflict with upstart - include all installed doc files- provide pam module- use private D-Bus connection - properly handle replacing a running upstart- implement wall message in halt/reboot/... - speak /dev/initctl to old /sbin/init after installing- drop no longer needed -fno-strict-aliasing - add README and examples- enable pam and libwrap- provide systemd-sysvinit.rpm with /sbin/init and friends- libwrap / pam support- initial packaging of experimental version 0/bin/sh/bin/sh/bin/shpm-utilssuspendsystemd-analyzeobs-arm-8 1550510404  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcfghijklmnopqrstuvwxyz{|}~      !"#$%&'()*56789:;<=>?@ABCDEFGHKLMNOPQRSTUVWXYZ[\]^_`cdefghijklmnopqrstuvwxyz{|}~bebe@latinbgcacsdadeelesfrglhrhuiditkoplptrusksrsvtrukzhzh234-lp150.20.15.1234234-lp150.20.15.1234234-lp150.20.15.1234-lp150.20.15.1 1.4.11.0201     !!!""""""""""""""""""""""""#$%&''''''''''''''())))))))****+,-.-/////01111111,2334456789:;<=>?@ABCDEFGHIJKLMNO,PQQQQQ,RRR,STTTTTTTTTTTTTTTTTTTTTUVVWVVVsystemctlsystemdsystemd-ask-passwordxinitxinitrc.d50-systemd-user.shxorg.conf.d00-keyboard.confbinfmt.ddbus-1system.dorg.freedesktop.hostname1.conforg.freedesktop.locale1.conforg.freedesktop.login1.conforg.freedesktop.systemd1.conforg.freedesktop.timedate1.conflocale.confmachine-idmachine-infomodules-load.dsystemd-usersysctl.dsystemdjournald.conflogind.confnetworksystemsystem.confrunlevel2.targetrunlevel3.targetrunlevel4.targetrunlevel5.targettimesyncd.confuseruser.conftmpfiles.dvconsole.confsystemduserpam_systemd.sobootctlbusctlhostnamectljournalctlkernel-installlocalectlloginctlsystemctlsystemd-analyzesystemd-ask-passwordsystemd-catsystemd-cglssystemd-cgtopsystemd-deltasystemd-detect-virtsystemd-escapesystemd-firstbootsystemd-inhibitsystemd-machine-id-setupsystemd-mountsystemd-notifysystemd-pathsystemd-runsystemd-socket-activatesystemd-stdio-bridgesystemd-sysuserssystemd-tmpfilessystemd-tty-ask-password-agentsystemd-umounttimedatectlbinfmt.denvironment.d99-environment.confkernelinstall.d50-depmod.install90-loaderentry.installmodules-load.dsg.confsysctl.d99-sysctl.confsystemdcatalogsystemd.be.catalogsystemd.be@latin.catalogsystemd.bg.catalogsystemd.catalogsystemd.fr.catalogsystemd.it.catalogsystemd.pl.catalogsystemd.pt_BR.catalogsystemd.ru.catalogsystemd.zh_CN.catalogsystemd.zh_TW.cataloglibsystemd-shared-234.so80-container-host0.networkntp-units.dscriptsmigrate-sysconfig-i18n.shupgrade-from-pre-210.shsystemsystem-generatorssystemd-debug-generatorsystemd-fstab-generatorsystemd-getty-generatorsystemd-gpt-auto-generatorsystemd-hibernate-resume-generatorsystemd-system-update-generatorsystem-preset99-default.presetsystem-shutdownsystem-sleepafter-local.serviceautovt@.servicebasic.targetbasic.target.wantsbluetooth.targetconsole-getty.servicecontainer-getty@.servicectrl-alt-del.targetdbus-org.freedesktop.hostname1.servicedbus-org.freedesktop.locale1.servicedbus-org.freedesktop.login1.servicedbus-org.freedesktop.timedate1.servicedbus.target.wantsdebug-shell.servicedefault.targetdefault.target.wantsdetect-part-label-duplicates.servicedev-hugepages.mountdev-mqueue.mountemergency.serviceemergency.targetexit.targetfinal.targetgetty.targetgetty@.servicegetty@tty1.service.dnoclear.confgraphical.targethalt.targethalt.target.wantshibernate.targethybrid-sleep.targetinitrd-cleanup.serviceinitrd-fs.targetinitrd-parse-etc.serviceinitrd-root-device.targetinitrd-root-fs.targetinitrd-switch-root.serviceinitrd-switch-root.targetinitrd.targetkexec.targetkexec.target.wantskmod-static-nodes.servicelocal-fs-pre.targetlocal-fs.targetlocal-fs.target.wantssystemd-remount-fs.servicemachines.targetmulti-user.targetmulti-user.target.wantsafter-local.servicegetty.targetsystemd-logind.servicesystemd-user-sessions.servicenetwork-online.targetnetwork-pre.targetnetwork.targetnss-lookup.targetnss-user-lookup.targetpaths.targetpoweroff.targetpoweroff.target.wantsprinter.targetproc-sys-fs-binfmt_misc.automountproc-sys-fs-binfmt_misc.mountquotaon.servicereboot.targetreboot.target.wantsremote-fs-pre.targetremote-fs.targetrescue.servicerescue.targetrpcbind.targetserial-getty@.serviceshutdown.targetshutdown.target.wantssigpwr.targetsleep.targetslices.targetsmartcard.targetsockets.targetsockets.target.wantssystemd-initctl.socketsystemd-journald-dev-log.socketsystemd-journald.socketsound.targetsuspend.targetswap.targetsys-fs-fuse-connections.mountsys-kernel-config.mountsys-kernel-debug.mountsysinit.targetsysinit.target.wantsdetect-part-label-duplicates.servicedev-hugepages.mountdev-mqueue.mountkmod-static-nodes.serviceproc-sys-fs-binfmt_misc.automountsys-fs-fuse-connections.mountsys-kernel-config.mountsys-kernel-debug.mountsystemd-ask-password-console.pathsystemd-binfmt.servicesystemd-firstboot.servicesystemd-hwdb-update.servicesystemd-journal-catalog-update.servicesystemd-journal-flush.servicesystemd-journald.servicesystemd-machine-id-commit.servicesystemd-modules-load.servicesystemd-random-seed.servicesystemd-sysctl.servicesystemd-sysusers.servicesystemd-tmpfiles-setup-dev.servicesystemd-tmpfiles-setup.servicesystemd-update-done.servicesystemd-update-utmp.servicesyslog.socketsystem-update-cleanup.servicesystem-update.targetsystem.slicesystemd-ask-password-console.pathsystemd-ask-password-console.servicesystemd-ask-password-wall.pathsystemd-ask-password-wall.servicesystemd-backlight@.servicesystemd-binfmt.servicesystemd-exit.servicesystemd-firstboot.servicesystemd-fsck-root.servicesystemd-fsck@.servicesystemd-halt.servicesystemd-hibernate-resume@.servicesystemd-hibernate.servicesystemd-hostnamed.servicesystemd-hwdb-update.servicesystemd-hybrid-sleep.servicesystemd-initctl.servicesystemd-initctl.socketsystemd-journal-catalog-update.servicesystemd-journal-flush.servicesystemd-journald-dev-log.socketsystemd-journald.servicesystemd-journald.socketsystemd-kexec.servicesystemd-localed.servicesystemd-logind.servicesystemd-machine-id-commit.servicesystemd-modules-load.servicesystemd-poweroff.servicesystemd-quotacheck.servicesystemd-random-seed.servicesystemd-reboot.servicesystemd-remount-fs.servicesystemd-rfkill.servicesystemd-rfkill.socketsystemd-suspend.servicesystemd-sysctl.servicesystemd-sysusers.servicesystemd-timedated.servicesystemd-timesyncd.servicesystemd-tmpfiles-clean.servicesystemd-tmpfiles-clean.timersystemd-tmpfiles-setup-dev.servicesystemd-tmpfiles-setup.servicesystemd-update-done.servicesystemd-update-utmp-runlevel.servicesystemd-update-utmp.servicesystemd-user-sessions.servicesystemd-vconsole-setup.servicesystemd-volatile-root.servicetime-sync.targettimers.targettimers.target.wantssystemd-tmpfiles-clean.timerumount.targetuser.sliceuser@.serviceuser@0.service.dnodelagate.confsystemdsystemd-ac-powersystemd-backlightsystemd-binfmtsystemd-cgroups-agentsystemd-dissectsystemd-fscksystemd-hibernate-resumesystemd-hostnamedsystemd-initctlsystemd-journaldsystemd-localedsystemd-logindsystemd-modules-loadsystemd-quotachecksystemd-random-seedsystemd-remount-fssystemd-reply-passwordsystemd-rfkillsystemd-shutdownsystemd-sleepsystemd-socket-proxydsystemd-sulogin-shellsystemd-sysctlsystemd-sysv-installsystemd-timedatedsystemd-timesyncdsystemd-update-donesystemd-update-utmpsystemd-user-sessionssystemd-vconsole-setupsystemd-volatile-rootuseruser-environment-generators30-systemd-environment-d-generatoruser-generatorsuser-preset99-default.presetbasic.targetbluetooth.targetdefault.targetexit.targetgraphical-session-pre.targetgraphical-session.targetpaths.targetprinter.targetshutdown.targetsmartcard.targetsockets.targetsound.targetsystemd-exit.servicetimers.targetsysusers.dsystemd.conftmpfiles.detc.confhome.confjournal-nocow.confsystemd-nologin.confsystemd.conftmp.confvar.confx11.conf70-uaccess.rules71-seat.rules73-seat-late.rules99-systemd.rulessystemd-sysv-convertdbus-1servicesorg.freedesktop.systemd1.servicesystem-servicesorg.freedesktop.hostname1.serviceorg.freedesktop.locale1.serviceorg.freedesktop.login1.serviceorg.freedesktop.systemd1.serviceorg.freedesktop.timedate1.servicesystemdCODING_STYLEDISTRO_PORTINGGVARIANT-SERIALIZATIONLICENSE.GPL2LICENSE.LGPL2.1NEWSREADMEfactoryetcnsswitch.confpam.dothersystem-authsystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.mosystemd.pcpolkit-1actionsorg.freedesktop.hostname1.policyorg.freedesktop.locale1.policyorg.freedesktop.login1.policyorg.freedesktop.systemd1.policyorg.freedesktop.timedate1.policysystemdkbd-model-maplanguage-fallback-maptmp.mountzshsite-functions_bootctl_busctl_coredumpctl_hostnamectl_journalctl_kernel-install_localectl_loginctl_sd_hosts_or_user_at_host_sd_outputmodes_sd_unit_files_systemctl_systemd_systemd-analyze_systemd-delta_systemd-inhibit_systemd-nspawn_systemd-run_systemd-tmpfiles_timedatectl_udevadmsystemdbacklightcatalogdatabasemigratedrandom-seedsysv-convert/bin//etc/X11//etc/X11/xinit//etc/X11/xinit/xinitrc.d//etc/X11/xorg.conf.d//etc//etc//etc/dbus-1//etc/dbus-1/system.d//etc//etc/pam.d//etc/systemd//etc/systemd/system//etc/xdg//etc/xdg/systemd//lib64/security//usr/bin//usr/lib//usr/lib/environment.d//usr/lib/kernel//usr/lib/kernel/install.d//usr/lib/modules-load.d//usr/lib/sysctl.d//usr/lib/systemd//usr/lib/systemd/catalog//usr/lib/systemd/network//usr/lib/systemd/scripts//usr/lib/systemd/system-generators//usr/lib/systemd/system-preset//usr/lib/systemd/system//usr/lib/systemd/system/getty@tty1.service.d//usr/lib/systemd/system/local-fs.target.wants//usr/lib/systemd/system/multi-user.target.wants//usr/lib/systemd/system/sockets.target.wants//usr/lib/systemd/system/sysinit.target.wants//usr/lib/systemd/system/timers.target.wants//usr/lib/systemd/system/user@0.service.d//usr/lib/systemd/user-environment-generators//usr/lib/systemd/user-preset//usr/lib/systemd/user//usr/lib/sysusers.d//usr/lib/tmpfiles.d//usr/lib/udev/rules.d//usr/sbin//usr/share//usr/share/dbus-1//usr/share/dbus-1/services//usr/share/dbus-1/system-services//usr/share/doc/packages//usr/share/doc/packages/systemd//usr/share/factory//usr/share/factory/etc//usr/share/factory/etc/pam.d//usr/share/locale/be/LC_MESSAGES//usr/share/locale/be@latin/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/pkgconfig//usr/share/polkit-1//usr/share/polkit-1/actions//usr/share/systemd//usr/share/zsh//usr/share/zsh/site-functions//var/lib//var/lib/systemd//var/lib/systemd/catalog/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:9687/openSUSE_Leap_15.0_Update_ports/a8270b8a77d899973d5280e40f291275-systemd-mini.openSUSE_Leap_15.0_Updatedrpmxz5aarch64-suse-linux   !"#$%&'()*+,,,,,,,,,,,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQR,,,STTTTT,UdirectoryPOSIX shell script, ASCII text executablecannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/X11/xorg.conf.d/00-keyboard.conf' (No such file or directory)XML 1.0 document, ASCII textcannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/locale.conf' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/machine-id' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/machine-info' (No such file or directory)ASCII textcannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/systemd/system/runlevel2.target' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/systemd/system/runlevel3.target' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/systemd/system/runlevel4.target' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/systemd/system/runlevel5.target' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-234-lp150.20.15.1.aarch64/etc/vconsole.conf' (No such file or directory)ELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e59acd8549c3a4bde57d0b1ecbb3c0c4bdeead93, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=c8d6cabe668b619de96b9f4a6ca0737b715c5ff5, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=6866de2be44ee147287b804d669b6a9a2501e8e1, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=4e0a13c1e6ee953e43ca8782153c2d33674248c9, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=e98c3f144bf54026c01f73743a0965b862f34491, strippedBourne-Again shell script, ASCII text executableELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=c95eea1cf65c8d02099cb8778f08a56155adc21b, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=10c038f654b9a2b503ad46afe4cd994448dd6ae4, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=05c62ddf8b2bf5b872c49ac0d8b53d644f747e71, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=000d470610fd658f5f533500ab64a950a4b73c98, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=37a45786c5caed1e1af0e77986dcf77e0fd4c4bf, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=99b921ef78e66acbc58ea2119cefddafd3877063, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=9061b9a3d98cf8c160268abf5b87968ade04625e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=b5a093c2c12cf708fe64bc6855ff91ccfc1cdaa1, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=6fb087bc2a621d528efa78821e803a00d8db0fe8, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=4b1b87d4bec7eb11d8848a16ba9dda35a3624984, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=2d1eb0b84157153b24ee8677db8249c21ace5947, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=997bcdf2f66ea7dbb1156579e401a35c79506a60, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=1139d830542785b45a120c29d499491e3764b041, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=bdb612fc340ed325d76ad6693599e46857defe6e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=5f9f54f5ae6eddad096a6fa76841882db3c58a37, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=376fdc3ac964b643d49159c656046a9c78dd8b17, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=03bee6c149bd3b91be82980bd524bf7437397a58, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=ee8a0d208c15a1d0e934042ac244f03678199b08, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=9a13f2f241b6b62f37178a0a0d64eb3ece108094, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=4145097c5ed78684789e8ce5ea1883d1e0dd3be5, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=c24fd007e3d8195984710d43f88befe3a6178462, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=d6ad14dc7efcb3ebf663b4a36a698e8eb394052e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=7ec90c83c6f26d345c43e457f86126c10c8a7e89, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=4807b7c1444266f4fbb9d2d5f9b63ad2aeca2404, strippedUTF-8 Unicode textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e7c75f111e73e8bed87ecac382d5529085664af1, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=0dabb28c8df3366fc3838d4bdff6b792aaf2784d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=6919e2a2e543c8e67f47d2cfd8a82b0dd480c36f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=e11cf597aebefaa4d66908639700dde82c67a01f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=4f86b12ad641ac186ef33cbc3e240cd695532e5f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=ee9275e93d1b7d0f93a29f292213ffbdfb58aa00, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=f738dd12a53f831b99ffebf0d6ac3cc754e6bb73, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=52439ee5a3199445b4d7e1edf0a7be16201d8f2e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=9a76ab6e776bfb96217745b142dcb73067beb74f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=be3f22c850868568d17183da7d65fd04d75a790e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=43ed34417cc6ca1826b7b369f0553fd4bf6eae78, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=6fb74bc49f366f4f5a6e07aefd63496b787c13da, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=d4eddc7b09edc007da2b9d926e64f0f9f0146395, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=bc2351d0538a1b013a448cd0b831c580af3f0839, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=821fece4326b8ebfb93876a9d68210a3904bb968, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=8b713e71164738ef13a8ad3fa7eb02bd937f1eed, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=7313f7464d9ef8b41f74f7ef736b17d2c9771eda, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=2b91ad2c7159c104221c1493f296925a8409b565, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=abd54e8a0fe9fcbb05396944abd7da155105fe98, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=e6b4f7cb897ed74484c357ec277bc7772c565977, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=6110f7e34829719c43ed912a6ad56df5121cf989, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=7a0b75a908643920f436bd4a9ec2c17c1c91e563, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=06a2c91a6685eea3861e6de27fe370e2097fcae0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=6f89021557616ec7f9c9328f86d9c0ab5fdc94e8, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=29d35afcc1b50af195fbbfc8dd423df5966c688c, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=cbafd3581bdf497699ae4a2a343e90e9bf3970df, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=0c4d0bde46b17f3e1a9ffb2ed3ed07de3a22afd7, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=936e1c866429655c729d8a8702f2b63e9e411ae5, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=467a9df6f824c013905aa4313a7e66a9abcff9bd, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=896847d4066f77e580fc1f70937ff3d185759bab, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=b503d812f711092e6da44b71e6ba01be27521c57, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=59aa6d98b2681437d8881538fdc759805e044bac, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=68ab816c1bd349912266346b9dca8875e09edc9f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=83ccacbd6926dfea3316733186bf3c89f7b627b1, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=c7a7f2265c973e0acef602eb824d4bf5f843182f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=f5797a060f558f62835d0b0117fac60d0237b77e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=a2375a9bb4c45e57fecda7e7ef04d987e6b2639f, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=e87292975f28223cde390c9d4673bc63a7bd8b78, strippedpkgconfig fileXML 1.0 document, UTF-8 Unicode textempty!'./6<CRX]dkrv| *.5<AGNU\cjqz     RRR"RRR R$RRR%R R RR!R#RRRR$R R RR'R R#RRRRR'R#RRRRR'R#RRRR$RR'R#RRRR$RRR'R#RRRRR'R#RRRR$RR'R#RRRR&RR$RRRRR'R%RRR#RRRRR'R#RRR$RR'R#RR$RRR'R#RRR$RRR'R#RRR$RRR'R#RRRR'R#RRRR'R#RRR$RRRR'RR#RRR$RRR'R#RRRR$RR'R#RRR$RRR'R#RRRRR'R#RRRRR'R#RRR$RRR'R#RRRR$RR'R#RRR$RRR'R#RRRR$RR'R#RRRR R$RR'R R#RRRRRR$R'R#RRR$RRR'R#RRRRPRR&RR R R R$RRRR%R R R#RRRRR$RRR'R#RRR$RRR'R#RRRR$RR'R#RRRR$RR'R#RRR$RRR'R#RRR$RRR'R#RRR&RR$RRRRRRR'R%RRRR#RRRR'R#RR$RRR'R#RRR$RRR'R#RRRR$R'R#RRRR'R#RRR$RRR'R#RRR$RRR'R#RRR$RRR'R#RRR$RRR'R#RRRR$RR'R#RRR$RRR'R#RRRR$R RR'R R#RRR$RRRR'RR#RRR$RR'R#RRR$RR'R#RRR$RRR'R#RRRRRR$R'R#RRRR$RR'R#RRRR$RR'R#RRR$RRR'R#RRR$RRR'R#RRRRRR'R#RRRR$RRR'R#RRRRR$RR'RR#RRR$RRR'R#RRRRR'R#RRR$RR'R#RR$RRR'R#RRR$RRR'R#RRRRR'R#RRRPRͬ'fQdH攽utf-873f75fc6352057b88cf074d33d43f9a5ec2602592baf130581fad6ce7ba3de11?`7zXZ !t/m]"k%l͗&}wrH)|*jnՈ E@~;pW$whqA 1|K*ZNlXEB1/^vXn#* Z8ND% c؞X:+NDr]\1Ypt("yxMO'T2"Iq->xfcowX6Yi: e[9]54q=fp_EgM<*,S)'Aa j!In4WF=k? QD.|y!-45aFwg+j#kA㏥i!P.^A +Z<:}OsTB?{}xo/\')IjTIt-UӺ Efk_Jvk/Q][T%>e'TO6'g˼8 aGJ }ӂd;CjHqGt ubzl5R 7D^W⸰VPyD-J- ,t3OL|[3& y1$^{{ t{m 8q4}&[yo\Aedqk̗}! }-v\x$ ;wJ99tN1G0&_o4nC|Lɵ$)پ(T]"}rWU`% eEaSٓn VkسܭN=΀IPӧdˆ[ ³g}Yys{`J!E"-.GsH.PWoa Eœ2cxM8AëFOng嫗q5Ť1qg$GzT1|#rO*v;p)tOֳd Ro"X$ƅN(N0=U &4Vj+-SJ1zAfP1["DViI h)Zv,sCeq_CSIMU:י~uAS~Ǩ|vI WBǡm2o}ϋLoW}fw[ݵ..oG9+S u_.0$1"[ْ݁u(&1kM OLYv\ dw:FuK뵄eP,WR3]:+kEc_ؤF1fJ|m&τL>mX0:p8,]Qw|\ڱ;EXTڮ.RDIz < Cp{9 P(GtySDU$St̾iST|U{~ԶŌ#,iWSwvi) Que"s>JrI!fBtu;Xk^@&e\pD$[) rM#Dµ wPf.r0E7-%/gz}$=bc>,_q7~Z쪙ef½G Ķfn6 CdV^-*㇕{|NY\ޕbϚ^ 2uX~hTMVJ}+NqWx*xo'j.ܬLm MQ/ &7v{3zhI S٧>]0uX!)- &^Hi,}qOqe/6~a̔eern.@DפIz/ caloK0lA׎*oUUWT%B2~ "NMrEk6R%vM_shV/vae>5JG54eW JˑBA5)ς$wv΀nP @9((4[JB qK,K!i Q+X:%]DZmMEDuQ%6N/Ea.~# k˿/#wjAl}: OmtD֓SGг0(( ߝƲsuZimmp"`"KҐ4R,@np͏K&F90MB@ ߺa͠_.󠮺!~wUj`tٵ\xw/| Sj_k#ZW'+r` uth[(}zęmlq"NLTؤW0z+ޘ 1o%Hk15 ۻdaP* ֗xWNAPbN_hT**yS' UjYNlMF4t4EEKggS0ϣ!gݤ9ZwP{s^R(*f+ېá{jmYr lA%:Wabe 95u7iyŒ+́9Al|};1%K%S:y[g]\W»`fN\7IbZi)*N[5FUus&_>7%'[[0 vߜ/IхoxfNC2bGcĀX.+Z ;K%;ݓL?vßNCK ۯ!2qh^YwxL'c08L3쯯=ƖE#n{:MlM+{P΋Q^R=1Z;Ff7KSo M/m6:j# Nr=ZX`(e z|o&&y7PH~SfʠSٍg0|W,پw=QØԥr s_e}U`hG?(7;syɃ&_DWL%lI_3wFs\lM:':^Ƀ.XG=~Q<]zݎ]5`P䱋m[T^Xǵ&nP'pJ bwfASe 9[J=^oTY rT1*x 0KjOnB@D PHEBSD`y/10j/vĜ &%u^\%mq"oCː'Xh23)fLmb5* Fi('hTzp8^]e2M`f73 *k|}'7*;a1u5 X.Jo{+>ʥ/fFYQr)!+?~Tc[:2ҙTi@AhYrMEgb2@homyѹTY9ܛͱ k?v*נ>77rڡ/3,O%#6w$d;o$@$I䌞xY}TYK\[Kݴ\;H_&`RpGuGO?k{6ϻu)!GFVEHcAlBnih]y2gbLX.L;Xjl *)` iWX(iQi~b{(L)n-z/Xs6 CYiБD4},/rt\=>,DWpuV?8 ;*G;T qaZ* 7L8M ;{3aN"҃yt PLZH }g L@e6i`a-E ˇlT ݷJzf<#J=Z_BbIzxrHEkTPοF?A (/,.DKs[}y syAA?1B{SYEh6 ]Xm#M'R1pO,y"ckGako,*ڐ(t] /M>+h1p;iv|Y ޱ2c&)%&s|Vު lk *M~E}[(VGbt~vd!Ґ]__&W3''GNd({PYAukEeۍ>&=yI/Qđt-6hbI_O;C_" f.I]_ZBڝ8b Ɉ|BU>A^k:I>BB{RŁsyq$@ic<Դpf̠E~p,P˒--A B=Lf!HL0bd؜8F˜넞l{Jך-nB"dPi9 wo 1nwSXSd{LQGR3w,/\WQͷ?eHʦ^ Eͭ%q4꣨^PJ'{Z3C_$7hб+4jkP9Antm+dX8|\x3GB$HP2[.':A]3!Xŝߢp$[+hī}]pG)*F_})QBX-D|5̌FqD]E>< v5cv~uq3k޳L 2^4§|wܷ6W22wkAvQ/e vz@7nWD[Vz \*%psO / RF5E…V + į X݇e/R=Dmց8If@+g]K:$wJCG 7,4QYȵHnlCγAGicFBL -f, Cu :Ma]ZWq0 g(zUrOXă raJ0c]yzKFkVn9Om5-~ytKbA85G^,YM<*aG΄_NO',4=*Doٞkڭ@8jz5'njuK wۙ v! &-{.'z&1(mH?r$K7ԱF|:qUn-v'R+*=4?&t"/LdUX _Q80(;uO~1Ly=1I0WzB_u_9()(EL{FUAYo8<ؕSq9QуI fvGYzӟeR u.d16^f? :|١@Vf>=t\)oSYDw-fэqkNQ#(Vwv@PE?=qw9ύǪtbh*͡^Ƒ $08Z %zy :ow6_=ݎԺphJE~w#bN C-)LY.AS້ Y}ӔT#e%ρ7?S'n) O"N3l{^YLlCӇ@sb#~^Btť|!*!`ϬQLE68}*GtHEB)V]2t]1˚Rl f~iõldz c>C<.j Uтbx6[, JSeaT͕ w [  NlW48NY5%j;_y`|o*9c8 =SCiBi7GKϾQ: gMFUiA9͋z4^C`Qe6;$paK ljX6h P#憥4S7,\o4w+/d4I{z}2y>I*}& Ņ/ #[NRڧYAQ~\ ?_sY *[2D:S=Ɓ1?h*e5 GzIVvWg)jan[ILOӤ63Qio '$_NRDv!-]JdA$$ƏLC&Veʨ]sjo":< ?k|uU)3sZw$zϊWKٖ_+ 79_9yD81ܐsTku$vSe=t07@R7{x?QⱫiK.ړ7idgĥKj$ QL$c5IL0.7;BxbǗj;D۸q@?wc :mpd݆F 7huM9[{#yWu,JY1X?ò2-5rR%2DF܁)hm_&: $JF-," i$וϫ0. Țn{xA4VHg% DJ ni:T@`c@^* 1yyE 1ˉ=G5yagZa%~ib57dEebIe kw38`i@/QAF%tA Gu5pOnS!x±YMOت c`*ȨsL8$M*k.YŷnDPP YNɌM|Qz YMw>W`]^_)tS-R*W6"@6~s*i(RMoZv"+L{W3\ɤKNu׌Qyl ?$MեfOo\ֶ>y {.bƀ䣹b&OR?U: &LQw k~5q)>CK 2 ),Wo5.펪4+4 u7 *w+f{3*Р2z㪮32ɜnN /'E-# 밨a[1sL| ҋlIw nO-pRG!l^2;L#&\+ᴰ?Ips*bO/}|/N&riha@—?(>WBNFa8Ɗoך,wHףC`8oā}~VY%RV-+.(4'5`j,igS3NT^󺾵,2Y)? h=bECѲ{r8 6Q  v|xBOr|QcKIeAޖ#Á}!(Ã'ȿ%̥c *xuTH>Ԝlui 0Y!kIj%&wFMtp 1..RO!hb">wn\ b&<>w A%DʠnC#:;Gxtnlh -,#4OfB|8*wΪj̽AXqVp:~MI^] g$|y_ȃ b0iؔl~/]^:Ũ"=$ET⃲6{w $8v@7f@b5q3Pz~{xn;Cm8K҃%J1[kqhG{:M@7Naļ#-6ym{ mPr-5@U׮Ke >seq־;OW`MUF9cOш[ִf^,ۅ[2 VTs0K{p7ZPIF Mڑ=`eQǧ"6zKH9kYHpeh$ֶK_wRF l7zO[6K AAU^̳-#M0}*: ̏ZvYl[ !l^"<${9apC5<m~gӱ3J"b =GFvѰ #OEd!;'łH1%zއ5 (1Ѓ{֊Af<2?D*S2Y0C|v.hGƫ rϫuw,UujM_8=Hf![(p߳ad 62 .Ş )c3=):G ,}|:K:Men'}_/})FT7S_KJT҉mI?PY[;dnLc?%K&Ms5bWH>kUFy%R )7Vn?>- b t`O.܄EZ+ch$\eLE1۸EVO͟4uwL)_WqﴩHڮBO!fa.@- eYEcM̖WQgm:TnUz Z_:Gbh*CtSOѺe٦0/_}Qc іGEW{i?~3}^j(eM| Y2r_n94];d,:O!oj=0SAP["} a,UZKo7AR xL{k/A1*bMf7/`XWAڬeyvU7z1S*KRѹh?,'d%1ض%G2k9o'y% K+>qqK%iQ; ]|٨,6lHn`|=!,ٝ[n@qA!S#:әn&=c/Qؒ\Khk !nP^b k2\ihQO%9D_x9uBvY&1 6¶ro08]@ֺ7=ʽSJ-&~ '@=2yD2H$4z^Ϧvk8rkN)g.zr7o?g-(2×ޤTn0P?+@Y :HG$Ӭ!= !zZ ;>%|;#m3r^v"Y--(rtf)L=\rٻ`̊\ΰf N|v8Q x<x\Wäj,rIL-JGYFm4QW˵؎5wckIֈ.Z({bl̂Mo$5^xm7WM)>b\ۆ nql#_ҹʪ堏JsA:7qr19567=nӻ!%v"]C7+]RR3y"Y*+LnynH)IҮкcpjm -vI ;BO|!V4Q 8l30oqF\xMBV!!4(@Y+S-;f^}twhѴG޷oa',BP{&$ H)ݰ q2WLTVtKb=UF_R^~ Xo \Fx;hMhDfFYxL/YvT2xniw`"w{+y[hsDDPRvbxPkS x%(&|GSB2+Rl֙0"6y N68Y:'Jn}Qz'%ݩ}w/ 7\BZjLX mS5#zU^a:5C43Ud[(>V ?dS0oZ=I*cڿ^hkl<4r5`$ |]WE^)8 aoh+7aіWgznmHf9RBɱt6a劗ݹ1M6A_4q]N>sip(~sБ|k)V ǟuՒ2\Ao׃<C>,j/$ 3CH>Xty KKQA} iL%3,ɭ/[~o_H(&B0cl)~crЇ7-,B3hL|we:i Ӎg6ЯR&bt? 'ǡ \?$֘JP$U(WZlHwQ鷻?w?oPvRFtla;z"w xkc"A3q'S +8pMlzx-Ze(n y0w@}S*dT>b7B\|chj* ۳x>zp\!?2i"u" G-eu:2dʇut^9$/ ZXvVFE'ҋo"Gb,+fΕ&)(57:uիB3\%CVzLOq /ʣѿ ?)0%1 ^OȬݸxky & a9;Sk:aq`Е_5t7# ?/5`awCv)4j?@B T6EX0TvwƆrGY(O/"tR{.ݔk BNLҽيXY6.{i>vLUWRQA`4QnJݗ&uYj5 \V4Iׂե"~= cI-· m+O`CxŰk[]wqD4,-QlH52᪏%3s4ː% '!F}|FG-:>;JE&J1 W鑎iNhAPecKyLuh3V' й3h]>GߦiDߴGjK T<{pT%D&O HȳBjbLmn%]յc>r7B{V"[jeOߤQ"iΝy!pdBL&$-UԽ8g߲,8u B^/‘#!r55y||B'4<58>ecV Id+K;r\z!Ӿ@s; MS^df+x}s18^;F3W1rZ{tSγ\i7XXWR~3A'YD avw ejZ^H%O_ɻrIqi\ i@1jmE68xq _TW>p0knnnu1`(VJT R-R "Yw&EwuNv/~(̝Ozb.N#>t3ok]}XdFEyЗ+)# Rv m)FjnIǎHa)NҽUK˵g".13r! Ω0n[9X[A;;UWC#3;1IؓT\#(ː6H%>dhD EeawB0׎ڟ%2¯3v\O'J5 ߎD"A96ŎC`elĵ5=F>Ao܉*US'$_uqҬS5PH:G=(tF 8k3,e4kptӂhْ !yMuk͗8(> ;v봦碷,ntA )^-s%r3tx~M8;9rЀ0C[\dVq^&j{-F9,ij; L{C/9m(wG<#(\ U֤ҫnԲ4*b0=mc3-L 7C*+Ɵ:mG·t k̈6Єa}bSb*C{6$l ̮7q黷QZLa\+04ez,G,qD+z5A⧒.c&ZL`Ŏm%16ʕPۆDAï҈EO'P1&|< ]B >НIB1r1/KJAL$ !xO(+?#({2 H7- ǠjGz[YR.D㢪wՔ4/}2d/sW9$~;UJ2B`ӋAa`H;'t:J>C.*pS|B"󪝖,> E<.n h9nꫂWO v-m1ЫwVlZP#'E''ZƆ$R(rZ$}6S`W{2B뛺=wӄgURx3ũ6xX#zGeYcnS |$۴xs' #{8 0}?ѶTX h|N7s3y̾Ovqtt ;Gt"4ڸYy,:RP JQdmFa}ۯhA49 mlE}a1\$q+D)gkIHBN>;pTm#Cd锬#nh`yQ夀88d5OW6w4jm?T\@kALo wr$p<=/ \ yrzJ!gSNX#mS 2ƽ~hsFj kEGfh^HaV(dBp'Wo\NtkУّ)OOCDϮW:_ߟΪY>I;VJ\K3U[WA>/ ޙm/4I Kl:]%fAs͗;"St93UkzDXstX-8?@@. )=cgzW0K)5w%͉ArD*T(:-A ^Zʤb[e="_DdտA&ՠPwݘI`QTr1pv?L%%hR@dS81RãkN5 gH ꐸ3Q_Y E?Xz/؅?d#O Ly1p}} [>I,zu>J39obLA V2 Vj 8nQ >uUP ^e/k҆_>7b||/qhQ?9O8l#ӢǁS[O0>P@툁O& n(f~G@@WE=ODh՛ 1re2{ xۑ @û ; a[c/Gz,3J# Z o邃&5;yQ֖ln\(;%&WSf_}8BsM*"^ݲ[ԊEk#ƍu@2x1֏bPut;AMIиwY?޼>.j)Gp0 hCh.2{iq&x6sQnUJm>Ċ&@B%u&S1lT3}[Ş^eU(coiقihyh\y . q}taU; ]/Ϗpy+g)DH0H\ck2'PUE˚] #yQ//rvЄTaPq :2 ŝ{|=~'xO^2Í5w4/UrXv@DFV5ERېҭ5JO)2w5}OB_yӊB{:#溨*!:pdfl^Ay~ .M=$e7,MWGH`ӥĞ9R6mI˦\Kisa)y4[@8]$\F]Ƅut;_AI* q[w\!)6FY! t%m=)0 "_ iL'VM,|埉cY\vpvG{&qk7auPHu8X0ƕB8Eh"a\!E7LmG4I~W VI}[ļ(Ca$H-:mx4h¤y|keehϻD^:EϷj6>2_*zEՂ,',yTcdzASh*vʠgY!Rwf#uBg!/E縔Y1Pp5p7̦1n{񈿯< o߷S">; )i2lK Do3?wPD0zUS:9ws83. d'0va"!qWU PCߧnЪxm#\;Ň;ݫG " PdU5V5)W#[軻M _EF팳Emn0qlwqiza]<[T=#ca/ E%oӇI3:tdIuVd᳎]NS8#E俀el9sP}ɚ'=uXv^5*j[t:xDNvo7ËaہYWXԆ}wNc04^+.'!BƠVUYD8EfH},ibKDOGkp 1AbU MMՓbв)q`D!Qε/#{N| CRVr ;9K4ce 7gHzj3nR׾% jl t7ouX~P#b64+DS}`im!" Tum=c گ"sTrÝfLҍ=bm>;V" Ƅ儔ahtFC!Tć3p?eS kkC8cԒy0?E T(4 9^ $u\ ՠK[yر [] ]VGel^ 3UZ7Y'ۏ[ơSIλuAV&j>fk1{KE` (T1e Oֻ!"6>CkԖHucv!_.U :Ie "f{]5004>iOɉM s\ݜDvĒ`'ZUr2:XѾKEBikXPB1Ps[E'd2aj8 PU>ewF+m+R <4:!{/C^3q[Ϥha')tG܃c=kIN yr)Q3 uwVs;Q' | !4V$s"(~ Tfo3݌lM LjF$P FN(%~]R%1'ϋEE3r6>ri ~v*ӓ8B~:vKбtQkiOc6jh^}#({S=}Ao ?I`\UDtj?vV =cI:Eytm-1BюODOm]Xp.- l@Az{u %VnF"90вuL 'ZHA("Wf3ʐhZ7{pH lϜFɂl KlmFF_~\P#od. ʬ{ cRyT_d{c F+sEZ3 c w-$pWe]3u\@ЄhǍ̼F LdwsYpir'u~? ,&c?cV`Vok_G]5Q2%&#k J. Uؼ;0?Qm KkcM|=tuj)hF?ZJ̰B$`c%H=d5l7Q PhKW/9QZi5Cm&D&" 5(?Qz4\3"rO$4Va3!Q 5^X/q# mvQyOG lQNTu% 9ca52: :qJyG^c0<_7e@ΰ-Tlp]$*=]t; >,۷ / o⎻gcmh>0J* 3װX.b낿)k ά2vM@xY 7kʷ^̩w5%MT$ScTe/*HBJc+H{&OyHXw,fިQ`i.O3<X+ׅt[b%SP3XH܍Y,&Diphօ@15hJ z:5lsiϑ:̃" EL6N>f.| p]r^ P39\fm!l6RD(k9I]xdcb#7($fB,dكtrUhIFw{o'؏pP[]I{;R pncęeHd,c=]nJ a Sz!bINPqz/l`e/?*/͝.;)<9mdTZEK3ב%883&eY.vykHr ה3Js2>(n̽u? _/\Mg:AJ>`g-.z0RM~p۽5 k@K`_[]iuO BUdA6S& |Z=3:v({:ju2O }2q_,^4APgKBr> 'WƲĞ$04o18'\i  LA_dmēP bȬMbpCΨe<#SIñS0ի?&G|Rʒ M[Z\ҟSSmq·g‘b9C40͗N߆;ȕj6*Ҵ- ϻ~Ng!)D Kҕ_WGޔ$Ư0GE[4/+\>:Tm<.@2,)aw8>!&][N@IBaYŻr`^zo&WD15fĆXਫ਼>L}36bΟwbu:r#Ylw %;qY\g]\CRm|B= LRc+£$ZK4jl$'apBcۓYI<!ͲbC~9ؑ m5ACc~7Dx="LӒL^FDj=֟"ڧ{pOn2l8T*XiHM;UP]?qfwvT 3 y)9.qk\֊*+&@#hr`&4y,pvYFAkKy-L鐨g`G1Q>Sd։M/ )pw O);rjMINpH5 AnUR *a@ȉpoNǮH=fCj0 a=o7f':lh솤cΕq7y/#?qm " _Xuy7 ϝ ZBЌ}=rAO YGTFRDŽtT{ʮfiwP$CNUğLĎ+vFxĬ`xʿ+6 TR*@Rxg^FGz_6R[JjFiT0lZa .NƼo0-! F\]OὄkVL 'б*l.akg=U]q 35 |R$"~#0>z^<~~K n xpIR*DQW|ږKC!U ѿpJIᚗV8_~2`{ e0KsFB#,OU/K|'Djb@vŃO&[HpFN_k%RXr~;{J6?aê Nbg7ZF3--J_ܷ}F|e4{(/bo?~YMϤ̸]yhFnbC ^jl D6 6sǢL[nEC_nو  zlEby +a:Ѭ(&hMj^U@oLzFJ " V}쒌AEM:Ʊ& CCJ]5Lq*y. ,=]5[9pPi ||,T3UMoOPM iPadd0N~V|ccLW)Ar?\6h^tE7fʲG"3pcΕ,ey@ A0qquK@#Ecdc1,RQ5#L34륚 VcIß{mVlWӦ dL \!y =QvH/:؎MKK8ZKU2i1~=#~cM겴q6OFp3oqitf-+hZLؓGkV2qT$q#.pڝ*Αcp! b gsn?^:' jMicp=_SsؔyK.cRm &W&`0>ۉOj9{&[{9IjP^ d[q_Dm*ƽz& zKJQ&@ApL3; dfcT_zqQw_.`o(7`Z,=m_p[C,MjDu% k0?Zn`G`MQ SKb~>y2ҁOz^,A؊͎jځHrc@R,8ʗ$;E1+o,bP9^:tidn @w0-Er::D qM#p'b}( k@MsAnzO&8ȇ1q,ePǖIk:Yճ0e=tt3~R5a[6]2f&@ѷˮ-VvxJlS ⻯iY}2NJp0UW$P:-0h\ɶ;A5AhlՆ@n%ٰ9h`9ubJ` ЧqAQ厠S6Cs?sˎGʷ qZ,uܘ!~l*k>LOp!}MBisv9CjЗk4ų`l/!5RƵF|13zu'~'?Mi+SY9-y\5Bvg?ֺ y7AbzB&O֪-E6#n8P-Mrx$ItQ%՝۲7Pȏcz-rc7L͇h~+͒;q6)2E]5Ut&"zG:IxvV0>Hxask>+&Q[0-}vUe~CQKfJtEqaԒۀv|LCYWHyΰ; _k[ꗽqi(Ec;h{%wQv(C+:y79V7tܷNnϯGBпlmPo^'F2H `ɾ4Ǣs1.nItXR=7ĐD  *6cS$& '`WtX,K! /G9-מ!Nc+g8*"TAy}Q0hpj:$a""׵YV/3L#RP4QXJh_\nW ZECW|*z;qC\.0Y̱JQqD?nRC>Tf%zR<Kq z!/d%tLDHi줻̟-Rk}LF05xK}/啊J/&04X438,T٧ipaȌ)9*Lϱ)'"`w &G˒]{Kj>u.҃KVE=ts15y-d }^HG*``(-KA>`{44̱a7GF$G OVc =R'OQݝm|\cG뙱,K̗c\|vc^ cųw֟ừ!Q8{0}Xz1rU`3RO.t>\˴@lvn"/zѣV.Mig)86U7wmuNíBbqݗZ0K'Fb4jZf* t9#Fg~ b3Frlm_1# H"~ =%S~ 9yC7Sh#lixz'Pfm8PqMZC+΀36ƥ鍌s$)q'ﱬX#.Ϸ]7Tʏg훿m 2Qnbƛk hހ9Y%7*1N涍 Vb9~{|*os̖$J}L~8lStiwd=U4#7(7x5\Qu0 a^^7'iut7Aq ߷mhat^FC ҍoFջ34G Y 8s6 Udk"HqW馆|# ;'IOKm"`߹CJ>F7+=s'ul8:8TAƁȡdeĸNEh~Q”MO=s-wvGN/z%W75ܮlpd@8$R^}aN Ab=e˛jw<u{c*6Q`we.x4>N<*{BI e@E |:ZXbWU噛E5_Bʹ>7px Nz'XTm{ Vpy =+U.R<0g c/LPy)_zС?)qW"qJm8*'8OZT,/"JOJ̘ r8p\ZZ3<ރmO;XZ]fTNIP@u[T`Vӥ( U#teM}x%H=?%͐Fa5ŚNL-Tvzw! .u$=9zyޭOKoSw(9'^ |uf:l\{揹}LX`B(BώRBj "[Jks6A/KV G"yߞ?>!]m=ǵ|९FDx˝.'Kmc<,BQp*]'{8j0tADwbiE5F~z-yMڊjVJ/}pt@3.tk6hfE>~ng nvG̖3 h:>ՅdEyrλ8U9"֤|rۙy[EzN'8E@~q.gaOC)0疵#Ke "qTEebiٺIȅL)voT@t90m WWݪJe:ɻOI|ܓj4m]/4{,5Nht\ߪ,20s(.C_YL [xԷg1-߻`$3eQ,,MзcAzC33s82kH1DCD |DLrPX[L* Gsog?+u`K8ƚWSͼ/φ4~$cHo26g3z)2>KRPuȂԡQGʡDy37~V%?\v냉.8 ewhC A~!@30)x._n?]o&⑅~L .2@ESfZʷ2R=`4whڠG`"+gY utL&5 ?m";Lⶪ pV6bԜzaz/;ʮ S엿~JC3CXc[4~CY;i•NU5a ^fTt|VPG'V,{5qxj}S嬾oz^nrfjəf %  t!a3Lm-4AplD8j,- PO䦤~h줬:*$=+[}z!HxOY]~^;d̳[$J"n_pKU^ 1*ⱁO~$?YҸ\X`5ԤmjaΨbN뻢][X4JZA^|٦EZWOv; ~g8M[4ؙ5/T)@4u8>P<Ib f JŶi{`ҧ5ccMt 3 sd420 +ٰ\O,eB T|*&ή,~ֳ|m㸞JYRl=.JZ^P? Tᨪi*_vQFr"{Z |(JTX¬~%qu.qa:ʢ$iwJO2I4'N7Aebk7J{^+}0mK-^]4QEd9o*ھ<۵a՜L櫆JZ xkpPDMlmh_S"ٜ^3_ԯ Bʢߒq֡j3WSpVa)D@ wXs-.e^UeL"ZzY93w݇ۋL-./ W#t]Swܣ+`BP+4>])~3@s:8uH?d*V+ ʪPFlG%%Yf+WN{J%\J}*:k>aSJR^gn#=Xk#왱2'1^ƶϢE`wf\iZn4= z[vr9ߵ](Togv͆VK3 miJ`ꎗl8_LeJ|)mư*IL:ct }WP-* S9z^PYv5Ilz5`1ėuZ-Դ],l{Ge`XSᣝ"'̷K@0T8SX"4 拮t1߱poxEO F@[]xp!;]ǛMqA(yV#NPY[G/KJ&<;np9Խԗv2-lFb1dt3yw Wq.#C*@\QʬIZza'_/WƦ"0p@V jO.>&ĦL;Xr nP /~yGuX^ /ir8qddnV~jӦ1 $nXVP zF֐&Yy W/ZiQFgrd12pa] ^:]QʚoFY LxEwe(0Ӻe񤣼؜05$,GzB'\"pxjΉxr97#I*?ȝ]Iaqon$̢]IYA 2_;[>;&`E͇S-hd!)bg,dRuܢtSj2 >̑{td`b"VS M P˫@#>4`gC}}"t$~UVZs'QKE^1I>ɸ\ M2Ä~dzYVO)ay f,+?s:Rf>BN}b;M38g9k5 4E(>4@h֫^o[s)?qf,W_K@>$I2FuDd ДuV| ;DW9Nh [q"gWp`K ;3@DUP]Xν*.'nڋ08̥hkE;QI4q[8._Zr^Ǘ>XZ{$߶ %[bcQ16CFyFҕS#*(ʴLUԍycP1L fǙCb5Î-&?uWq_tRrsΟN^wpu~VNzΌy[5JnV+OW!EU Jߩ7mbf@.z'pk7 qgIw]7-78-Oqӯscy \uNBdb(KҌ/4m[$>n{u 6%i.@5ao|1#GAFQ ]\ܯX&3w6LW ^X&9(øW(dzr O"L,xvA -HS"cUìߍ9P& G=ߓIw8[J#&z;vBMBDLn۰5qA9Q('ԕF_"`RU9~j>*эӤnđU+)$l 2ߺ`a9~Br-Gc'̡@// uuhc~jM:T>X&U'x\wdQk<}ט[UМA]w% V=Mk{6d瘍(MEt>nSu&\iL3#i_9PttwAA oi5xQ4|E,ߜW.Ako'+%ڗ71:W }7zgu}+R3OR{OTeBBp7t3g;vGғQ/z?d1$K]M9ʹM]G#uSMHI0mVVe*sNfLЍ{EaKΘO_N@UU"EUF0e">} ;B=ˊ-n;04Yd8K'נ|=s!}IG*vԕZݮdޠf2 ^Z@8U*݀~UL-SUX"jݳ[ 1⊦ܐfC5`m˳|:j1]-`OOf%y9 E7!YM^u%9INdl-/w$yqp bWl7 I%;ڦ`e \Q~OK/|[~xwSd;y ك`\ &A(ܐ=MϹYݛ4.%Ik M\x$amdUnsI&=l%4idm)hI.dDUv3n\QEC"! Bt zP Ssb κ PŮ_^,->c.5(1I֐: ԋ\ե<oMv<A}hyo.D u1NrL81"X<y+3̨9[ 忏LGiYԞ]| ? "qw M&3/L $fRlHtU>Mq;E)IDHa S^>xV+и٬ʔI]5+e#T D⠳yoi x %;Q XWV>$^WN*-h`*1=7y9sS,UԽr,Zl iٚvf&v^sǐeo(QsTU_neΝZ/Dg. f{hE^T7.SW|F)mi6o[<L*%wDɬ{8Rfć[{ooY8GbhІMڳT)5X#l:u 'ʹ..z 37gElk \oܠ^_I]?tA)i5bl҇um_ Nض外AM3#j=:KI}F.CxI ᜐe1p G< ]:ňMm .ߝn7%gCOk0O#PSΰˠ>ԃ JmzB)R&M踿$-/CџHp 3dcagwSe$ Dv4&"2µ\ʤT 55sJ:#h2:)RAp8+E鷻 IhBg Q ПIUZt9G8GatX׸$?:Lz/1h`vB+ӑ;XP-gܠÉD2!xO*|ivЗ~RY\Oz @ xHiNKgq%c/QVZp]7 Ǩ&?YHd?stķ7ʫU:nHl _MOb_ݢ~Y$ ӄl hJXk~M2L4i%glеײ<4׃E$Á}(0# ";w4Q^gAbɷc~"qKxdoY/(km.yú@c1Q2kb5V2Ss./u( 9HY_NV1R K?ZUܟ?қ٧lv-xyNvOɚ.B$#-58RR$>]SՐKBxphfTDžM/xǨŹWa&VsC )f`,*l:s ηH1QC$}AܱL"I ߃?$qٰTZ[h˄_ kDZd_6k <(_3#ŧVMu*ć\#=\V6 X885wQ=SAUZAK e>^$ dFcnj# L%S>R['dp-k Fpx |zDxn1fikgX\Xy_cvEm}(_ifʡNÝιB~"1m`v?שŊ-L_gg]FO8Ť$2x|h*}ck-q7#N1"Ȕ<I͓RVS9%mǴ}-5ə8Y=C ӌX`m,(Cݍ 0\Tb3Z2WG:(M~AsDpB 3ɞ}6;Yv\GSB9Z]0czw7" E,Yt@A*YMJ\W$;m( h JL -eHӟ@f=ХFh8- iwu&uժ WRu"8}<.&|4i/G32U/ظ/.|xvn K;pQMp \Eg`ha|Jꪰ~FtEV~;ZM7*1fP+ ˆx*S(!& -€WTv:r2fG)ҹ(NQ,p Isѳ@jNpX82# 6IWlrMg3u ,g&T׺4k{KH4D030vxYK, wmސ9G)Rr 2/gm 2| ~ۙ;.FvZDC-g6r eS@ÑE#7$G3:K믥"v_0ܝ^&n= :ޝ%r8UOb(EP;APY4ߢYD2={8`XALJ|Sn,?F3vuDXcl-l+5q"HAI)ҸM=N1a 9q#SLs7O|\ʵCATpiLt2: jh07>+@f}* l51d+ OsStq]|e}V%<k: 0lD1^ h[(mNùܳ?hnLxbȳQ#噙,\t{(@8u]zv ]",O8 Qi7=˙9*вHրq%ف 'ZJdSXmi|1to !`2怌ǞEDE|G*}o64e]1Sh |'RpJ@\IU2:aT.R쥤兮rùzxG9 A~ڤf>xZ HR t^kFHӢ Nl~,W(k{u)K*YȌ浟?U&n%XLADƓE } Ӟ-pFd'XAVNWTz 4^L[ ~``ԉ:mCy'C1 45Ķ,_4̊: *NL 3VMKo(QkD@8Q•o0-X-mE串Ût7`o ,Om08Cd'\+׫ Lxuw_dv7TZ30;gDpH62.tuW~;"v#\uڀf^B5 :-j |DH˨``PZ4 Uu7O-2^~噉z}ہiOܩ|& 9ZY;25GҦ0 J3N*)XJE&']bg-SplŴpyd$8 ea u:uy>fd,vOw {U]G! - I -S%%Z qkT51F!jnGSxJB7I]-ͱ,ͮrP >H&X綖2P # Q 9R5nDw8%NFz=:?k]gLu{s)O&gq-;|{Q72O}OV{{ČNpxH0ɨ[= G' k6n%L?+[#sё9_ A ?A3#'EzƢxKt WG^<$7߾SϴfEYbI~ ඄6ﱳ\,l{ u UT!mC[(YD \ٞw-j!bd# zd{Vϻ5F v>dT:..@3]^?Sɴlo]ҨtG-,54?P'DO>!wACC/BSΊ}Ώ-+&x=^.^.*f?*i6Df>ܵ I[{8ePa&`u h9ϋ8^߼\q̆)CEsd'pev^0St-%i34-2jmI[xUbc@%9Qc g%PqK1"M ߪA*i$*@N*;C%ia쌿(]M8xQRVZ18PxZ^$ Ąfx1šʲe26) FJ(qVLw- "oyK#>ѮvLM$C v*~,QIoEzIu],_윭#a`YȜ6-qO/Jdz ' H%j Q=vM_6)q1{)'b gL0 HHք|y֮-y1M)6sb^ 3<$;;d.:5JŖWS/nʛ35\y*8<#ċHd[%R+^=N|[FC,ӗ?<34 6h `^'n c: qܨ8GS߆;9.N 99o)]4d MD eƫ؝9P5a0g?z` %X@ޖE T[EMsM".A11,l[s4Ə7A1Z3E7cXR]w}+nșrS=!ku @j ~(ax.`OG~O6m*#t |9/~)a8aSc#W,#"Z㵿s^1l$yg^إ5amYL>ACbm9FLjQ%(cʿ `@ ĶQU٫oX0-/3@1>n 4R3WӛqڠJP؝I0&uKrFsjب%oi Kt:PpN8 Le>T\5ME?X" osXy& r7$y8dLG{vɘ7i({z,<;L=qg Vm.3R5D4t_di_ᖯflarZ<:_,LE4.8x/YCT^=5 h>؝Y(Snɐi.c,./P@~OD/ ==peP4TLp;ܛ&UiM֛r01G0@w_ݿƥGu,>+=%Ny3pnK*?Ґ ophK3CaTD $Z<^evեl}Wfh,G&,%Z!n$VL m>YGJ8atc S$W5^Nb}js PHo+ĆxIuxzdO?HIyKz?`e񅥝hm3Ywt7r,(;0i9UoI]>Hṕ6BNxzҊ^>^e &Ja~o ^ŢOHC<^)E YCDvwLyZ49mO2%̅A}(5+L/es_QQ\u8\ CbBfe}/ԯ-Łg_Cʢ>)1^5*OZ7 NpyŻ!DBCh"Pi%@[!SQaeƦ< ѴT/0U%Uĵ\g2L[gP&w )`%3maj.hПXDz&M<<>:OGDrAYzD>R#{ X/i?TJ##x8j֏+HeJu^7UE[?TeHjaר'Hh`Qv8w(E+.GnVj- N߅|7]DW+\EL%͚~4|UԂ8xiBb?:1skBVk[Zmyla-ɑ\1} N,zrH RtnOfo$Y#/o,xq߰&`aD͂ԣ>X$M ?OFU}iQ.8\uV KqtD #uNk{ZCD}\ԿJ{0,WL$k??DYb|! yERNM}E4$c!0wn#Z1tFBwCh?,/A H0!|Pb5މُs}DDJ[V|[3y1?ۚFH hY tmv_V`()UNy#@\!<y* `]NG8qgfhq)ߪ{د3DMXUH_"VXnZ&wߙpx_N!q s 6YOL߯‰ 8|F"ܪ7J_QGk̦Gv>C[^|#i(]SܟT?L5Tl|`U`_6<ݻQuj7jJiH^4zc6T>Wӧi/I=Y0|vzEXʜm7@B[2PZPpcU6%0ҁ%+|7ѓT L.Ԗ&A#Ch >fQ-6Oj ~DQy3RW#̅XV O<| vZ^z&Wo9ϐXףMzzI>Xu%TNJ92Fyj5O7 0[lˏ 2I5Ѵ`Du#?q퀭yeZ]WVD<qإݣy 0)?|a(@h*jžP{5RNᰚ93Y CZOέkl囂c6Kx}?sDW ڊ2?@$$U.8X!Q,ZߘHO>.íTNT%+9{m?Wߖyܳpr?NXc\xA\*&9dJ ww 1G7s/q,Jb"h6̳fYܬFԻ w-0EU\*អ8BN{,کNSR*eel`6ӖU;ykΪ]1S>Ы-9 oHf9l4٢T _nA}[Dhq@إKzH#?!@+1xIMͮ6ڢ@~kY0ЍưT~"m|jD^w{hLEtN{흅Akk/$HY/ @+uhZF}6?Yp ~R'z#+M}θn{E4K2ZFF *?=Iď1S2 #^RFc99:溒+?\}uZ% daS5g&iLUIPV =.JaA<(̈́_-o No+th^KPԵ ;-g9>Rĝ Nu"iUК d<4bU.Nqp@0ij))txrFjq!ilwJuAe \*+o喋ڛ/HPA[lEDX̯x/c𣾥"Ki%[l^೰$(/Y9;85$n=V: ,3kX-^>ڌ:cFXyNMJd 4QaLBDzzk6Rifx~B5bq1QfW E@GGhAߏd_3#m-ᥘӬiCMQ|dQ00֗Y%ૃL!cN6.[&K’VܯWVScyye ' 9Ư_s:x uR>dݠMLlâӡi5 P"c.EDVC Qci:dO>&h KRoH`-2\1Wο}J5̦`6JЅk%"5*;WhU`M Y Ol89gj u~ 2\=@9eV Qg^&dbPS%qEz+\ 7<)}DNCC?x* \)<6QH}O"9Jq<sh>n&Q ]jĜNV9 eJ LÒp.dS>2?T;&'q+5;1ZV- g"ک ("U]0sȟT]WI &f4mT11ڑ+ "Bn0➁=8 _|PC U HIYwxtҭ Bou(W|FD9T1--tzj/%` އR3d)j,O*PfY;&<|ЧeqX Sl(G]=ww'oT5>ׄt vfa)X⯴KQ .*n'쑶pSlDGϣa$(ଵ?aEͲRgtHrT52YRhV[oX~tյ )fmN/QND >iw3[Z ?R_;{,RIPI_r1Ea?03{sYP8<'up3]d GbO_fw() iVcZexFu f.yuͻcD讘?EO QU>X2i޼G|K /4:%>z'dWSm=^"ętICMX]XMJ}I? 6; <]nw1;-W79e-J[Uޝs)1HgȥSDZb[m9~U:qO[X֠O 28wʐ/uaȵfO<^yU=IB0xmlǬ"Vt'./N/|?V{쮏(p"f`1]RĦuk>^)|/ IՇA'Dcʊʶ!̰<ѠT8<0k$ |:\xt 'Ƈa;,KC24v_GK;v!]5=X%t5'22kի{DݠOZ2nW--sA 66b\*]'`dAS Ufp 6No C-u1'_9m8ِ@Yjd5g_ZŽ {oo枉k1_~X 2.f5@$4Cw;Zϸe)9T}'7C\aU{tC`]cȱPyEfyO#\Ҧݚ}^&N~| Mܓ\{B k}pa2>.Dᠧh1\h[1ËtVI ΝɣA0A* XHYjs,B8 bfѭy oIQxpzfTNbV0qPߴ/S0}5Jcdɉ J5v"H_z1p,qj;j"O B_BMCp><֩{AAiÈ]_˥YuzUŚhi/V$CYA{- @ܲHTl>yb}g֩ S`%ܓuzjڰD=p@Z;gOMKmCraUŰ:5 wkB CI bLf#Ni 1(c~…FU߶*uD]?ln&<>ϏK{<N1.gT߳EC7Qk܂X;rKp0@K[RРV {0`^IH)b 1hZY Y*H d8/8AH eL x`/|nX |E'󋈐 f+d- r"3|Ώ?ϯHD}#Hܑ׿.+Z{tNA1Z}% JQs8̈BG*<"ˈPc rlb Īw9/$tF`tl|(@i bwƤ)LGIn,o '2EM3nr3dXwuXcSbIUh5'L>-xAp;|5_MeH3- PxoDhUھ opκvh8EU'h +6m*Nu64_LJ{|p*?8&\p?J6R"{Dݲ[nLَz`O'6GFq/&1/(pD4pSOH69viXu.3!qyW%Q ۱;dv#k^,+cISَԈ{M Me!P2`u/@!!Q{$ٴL7,7`'n䝋X: A8UK=!6 2eg~F(4 iz"ŗDG T hf*V}pbf6v8Hv 1( b\2CD59m$m||.A5< ڏ5KFF j+=uqCKz Qu6ѢJ,wz-4 3NY1C^W['_C[E {BVaY٩?"J\]T-&Հ0[Q$}hXNW|K?%;Q1UpzkW>_[՘3=<<', ğ΢B<,Y=H5LYwlOA5:12U<娯z`7OJeG-Lvx4;%{B~PuE2h\˳ /-FFQ܇"6.Ԓ (h1xӟC:(&9L2s"sd@ct<[/Wo͆ЀܼWD:X9`fէYXVt6~ikNi=d w|I׬*#I mwcj ҸCD s!Ǒna>x^>+e +sG9uS{tYs+pJjh*q 7]2~gwUvV̫Pw!GfFԿ>#lh/i!ӑtpʧ=ygPj r6grSN& ݴ,umR([Kgs^.xAS@SxFpW)`V S4J+Hڦ@52y =Xn`{ɺ]9ipKԆ#U"y<*3' hFGLZ\ALl8ji-88povRvt|>rm6rBNYb,2 |df/=UBu@%30M :yƒfa#Ϗ}/W/IQhE!0J&!LQgSyz-; r :?6'jưOh1#01CZk'- 3"rY-~W(k`V藮y#wd Za( <"6Ƒ 1.vA Qϙp*1Y̱w8xNpxW9 φubIؔ8D1_@N[?^;{QT̴ 4 cӣ{%}@DBó:zx a}/c==eǫQNk1k%qS&5Opk',l|z 4+.L< I=̔c`{Ǔk"{WZ'v};&T.bYY#n]L|M-~JP7A("4^?Bzn-"5GDX#"Ǝ zǍx"$wKI]&Xln/Q"P-E=mVMm^P tu<8>on.w6sq׮4?#?[ݢ6de(<h\u;r0o .b~u󤇞wNVe0`!2ˋRR cBK?GIEKJG s9Yc=#s>/"Ҍ&f'Or4m> ?_X C|<;6CС&R'eP`ԩ"CTtLr)>ig׈Mۍ_?2sq"2:=&ᙒ 8zC7N.9&d=g'36F^@tc_pM<xXOh e;!"K{rF0Co~2xUw"YKo $.!q))k=[izPP8JP"^" ģ}X1;?FP)UW?E=.G6k㯫lU>{M N$Ju3p|jy J,)re~Cs"8M1Y^'{:&yprQdh%A-&'COH^>H7ceKۮQ R9ZrJV++!Ϛ;J4wLMٿ+{ߡ?J?1^x;TzX "۶E&](X+co.pUhS=YF`*pUZsCYU'e-D@ݤJrl$'X>RM[G4E.:zvdҝdUcTc!˝!5oIy1@֚Upnٺ3 ?!W䠿2Oߓ76AɪfJlL@ E-S;HB ϶Iu'$r)GѴmHTu[ ?ĦPuK xpch)\N~\h='JBѵn_zNJɛ< \sˬ$1.YKtC}8HW4'!pC3d7zѧsT]v9'\pKȄ# zuLV>β91:{kb+6Ny445Hd%Bx_&oaUQN/wC(|S= rdVXO';678hW~Z~!D+;fx=DF;C ̢ο`tTYY}|buBGpI3"²dT'O0e]x~i&t`e)#Z"~cyJu/4*H -mX? Zq H^<\ݦ{]z'J\nCr.<ԯSm=cw{ ޿ i{qcɍ@k*mHl"W^wAbp*c^hhl6H 8nѯ1V9`)%5IOM_V$kjܘ0IC"fl8%{2 /p14/腬Q{pT璗ky|1?XTw$4OBˠ]s8إYnē8@?萓mt7%c!ǀZbC~4~&~'v|0SgnXt XxkH:?Oj@!W8hBӑ[y=GK&Vf_Ć Xےch?L9&#Oínꈪ)'V6G+IirySsr#JBkMvJj"{NqdUY d[r(A@A|YrfhyTՖ,5T5Yj7^L;Z;ĥ K(-]j!WZ5Ȃ@=N*ZH܋ijQaJLr (,kq xX5d(ȄRs; ^+O[ ЁfVwv`R\k1L:|] Ji9Қ2-JR5 a#` KBE,ԁD.)zws-&XacBl7"H>xL=jMΤc.CP lBT*)+*J@hddv`R׆ *)^mK{:I]7JMj^ bb,mn,b?k])aXTJyz$S*|ovy 5F3isfym0_%oIcd/kǯcg+*|x#fEX z2xd84}݁EtbeYvU{J`8Y^v_mu9> J >?&SH!B }B*|"&UJ~@ 9~Wcp2MB}*ҧ_Oq;_1?N>,*| 9UGzp'QC"(~&9^?;!~%`RqhW/kç"7 d= ȇxs#tq})=:R2ka8~K˲u ̜)ԲJ4iwlxp{/ޛqy*-21jm"ͬʼn _m|P"f|`v ݫNwV+8AFTXڣV-F֋QWPۇ Oh! Gt0XgdcObm~6kkt`~q' Ё@%#HP81t颻}uHa;5d$~\cl/K_-m-0JDJ0fDL(%H`C6u.Z:<v6}D8990dd%dks)a$@ 2m9.0}J)'#%7kح^g~ _us=9o?DJu?/v?bv~ 7n>T>/`g߁G|N%{oLBh0/¿Y͔_?U+w&x$p?(?31t~I>~OAru2#Cvf7W[4@D , ?(C|Z(9ڪT$Є`.u82'*cYy愯MΰFDI $N @sYs',`.HWGH*v'I I,="Tju}o[3QT=^nL+IR@/j}[kB4mu3JDEx f3.澺3m"m:oԅĘ~X|^4JdcvSEY c?ß`Z@o.7m0[KIwh&anC,jZ}}[\2eo\NVQ+~oׄ C:R?ei6K/_vTl9mx:t0}_-edXA@B'uFA7:<\Wn1~@Id*D@i.=ۭnsI޳ٽB}z_U=?~3oj|="瓙[.=ߊT>, ?|xA<~/BIcgzA}{w(y(H C~ !!@CW\d{2 ﯉yAs{s]uHyw$<)tܟ=bq̛rE^ @azqG鼭w]9Qkis6]#| F~(Sa5wRNvn޽ZiK |x;nFL ݍh(z=F鬏:хʸ斳4 JRvXREU\S_aM3r-')zVݒt]Uݷр "S֊B}VBMQIÂ.ѱiɃF!D;WQ7Uŧ:#> do>$zy:Ofy;Gm7$m\,amoc&`|qM'4'\n.?S3`4jab88d0W*sccj|7%8}{(6uqu֛9Lcۖz]0Ϟ4B<;MkUVh:E%l4wd_G/ oYMӗny̫ H Źu\"]'6P3[9ztۅ{tVLصMQ,P>n>KW~{4ͲϦqլ׻ {?aJ 'u~`[8LՕYat; /#BtX̒c+IV[[3!:aX6;VdEk sq<>,G !jTǣ?7*Fʋc> B0>CSڀŨVO54q/Z)%6A/G(K,%uً)L86\5R&#s GkU4:.ĩV]gܴe 1Vîmnѹ]nr?cq^)ﭚwsɆRe家\I^7V <*[3مKmS:<ƐI--_ʼܐ+{Lϔhfۇ 5 a1ܲO5{h̼> (zRZt0Rd(wf$0>[JzS5*Y7QRmyr}7u\^1fGtfǜ@zy) -O$@?4yЯ }m@N~tQ ;T"}o U5zHnߣ߃k~3&UA__^C#^Ѣ\ouE!<)_R׌Iʀ[[(Or8WH=uC8JOy.WTLP0o7!sDϤT_ "  1 D #Z 簩24'e"|/2NVH"_') { AM";[SPjQJLb]2ag_hf>\\Cpy7'gIQ HihWOL.8>~ospٱs| 223jѩÓ N|,2CG5g I8%L%Nݷhul(.OퟗUqh=b 5xmp9iiO QtQFsk>.4Wm>`I (R4Q^KO?rEk)[,1d^{'%Xk@-"*4+:<+_݆p&YهY0o.IQOOe8BQB}MJgٌ, ^ tlak2* C 6飏EQ J <,Ȼ9gͅj<80BFa^}?gS t<ͦ`˜uUC.DJG?y?Ru8v43¤@"$<&ƒVT3CSciC(zE'VbTADU|^%x. oߒ 7 =RxIOfa M̒XR9iX1jZ,SCZ i$8 `ezW>s'lt2`$/MT~MW͌&1:듵VG~1nۥXvOdCV` CL㓨ܩZ^?V piHJ`qܾwxepVtg]KfPL8jCV'OO:]r؛iSK͵(jZ( 3 <;R%]1f9lAjUAF']t՘C*ʳCkt8daǏ5x:oyl^0lnӣ[gVC{gNlhg5$(*ɟ>[Ueܘ ;b@I9D>@|L; B"B p ,OsZ0$úgyNxLmmLRE,!t*^q^O#$\ӫF|*MO:!pXO))} L)$fK0[ o ]~7:W aa0aS۹L#'F#nJ!>p 22jEf<4%?J1ϋ9 YQ u&I [+0RBCkMݬC}2dFdy%hK5Ě%kE C@Bqo$DUL Q_ƅd۟2" }[Gjlgg`c e|Ǔ`k[gN$(n&3[{ C]WQ4riz rbY!n2K 2DD@*v-BSᣚ޷\{β̆PZ6k܆pӢ*Ii'呤8\wܙl il0fnaQʶISɖgëY*j."!hSTL9@T "rPx'%d%yZ# SJSD@{Q(B!49UQ>kJ΋;kzOdqE/n!jX`f1-/3W:=|\dLB~40?L5<RDyBtrU"L*I$ R|3ۛ'G;H|!7{)/?Ymb{sOYOsD!n~*0=ܯm|R- |ħB{HK]ad~ߪB_R@>N @d͆;!=ߧo@c\a&:v*{p38_ds<Xl BI=W4x~"_Ҡ֓< ^^סnw V+gWM+\L%}2/K_GYr򼥂 4~n;>G߿?.:_?^>h,~@4$ < ڎn~S@HC 0?pW@ŏعG<Ȣ4{ǂ+H+4$1Rd [P3jpU557n7olPLaѫν`]aiFY.RT @ MXL-[.fC\9(,mf%7x:tY zS)9"i9_J0$Mrz(Yp л7ʚʽGm4D<9 Oߍk~#[_Ɏ'M 9;kXI:w~>ocl˽OP6 z /ˣ'o|)+tfL~kKrgvܒZ[j-J+rjEyqމq$Wlӧı_?JyO|]fܺ/Ng9ܭ-T#OAE3 Nп=KVGȩpqnFU&:W]h_bƛO:Gkk:Ieq9,2<}nSߙ{%=ҧzr|y24l*fΡ.G9LD$ynPZ|[s$k O? Җn[l坆aOs=K?;a_RuOQ{:vڃlp<])f:ޭkr`rȆ-~o٧4)g"gaUvu=w=x,riw֗SY-,m~NNOv)kFz^u{w:g99SC|F?1%`>y:3<2 e-J[՟nRM '7^jKy9qe;j(4vpծlYA+ջ1pÒVxgRA OY`֠&֦ܡtyd`Y{ED0ta HSYWQ?qqfYutv>_BsCZ\ûep6դ"|roKm9MJԚpfv1ЂJpRͺ[z[%ᛱCcrsdnXDn2n5sh0ظf<0޻AO IuXtN}-իnCJo#"zT)ХChX5 g譮9Mi|$z1 F™nF6m4ko8 ,-MINk][=η+~j`r۩upk8oH;hD'JUCBӅ_54I_z/㘃u;o)b.|!./3K_ =ÿ%o1 z-_8}þl\2Ԫ$m Psoks|6oizr= Ba5.Y7:^j8C].lȗۄ% 'z^l,Q48(t-vO<޻j־Pv[EP ;7&Bܘ*=@{  a.9#s?|fͣV7D`$ם`)r`,,Q'X~T%M(XqR;.4OrU9MZw(n֠ Z '~(D2Bߗ y=~HZ>nFOUdJNv=9aFޤi [h:Ⱦ/ϑ.n?,0Tc](uq%.瓴ʹiyC68}`'E7|b{sulzzJ1oT^*PV>vlUnjmVz lE:1|a~N)(OkkAܜ{J !-֠fkōq-|h~x:>Ef*L b,T٬%Ca >xw^)lIs^Z%#=& ^`B0>'¤XOmAfxK( ^b=̙ߢ-_4t"o6sĮ,f6.)lht߿ΥuHzTnUq}垼ͥ oSK/1HL히<;RV:t>Wl|dkו6uk^tI[fBZ[T @m#5wi~沘!Q7I.^pĿ8h+oE,\#JTIL݃?NO0ƾOncyuB {'FHs|ԬYq0K9o6 |-kR<xXݡg<$5匉q%, kK0Gu.dzSEm\it؟ 2n#IoFC[[g0!bL+xCX]o+vnv-YtP1NNԦN6/! Q毦VJ:@IZxx]i9fj3f5?$4k_t.Nnl.żu8}2qZ6rikhDY<22$` 44cqBes cb Ez nf)MS?$_[y;8lUp)J37L] 3nFXR[fQҭBkZ~ 2Y{'ISIkP$kq/3gayI<Nz#VRBH3g dHW!62&fTa?|)5)COpBw9r bvl{Eކ/Ip/;r=֦Ygضz0^x#yy]c-*H}iO__p|#16Xu-/gshϘǯJP)Luj`̾΃ySo\~є)*.n&V'Ƈⶮq\P'T;q'8 MF{2l4y޷4 y$VjSr[\;nZ|c\5-QO}{1hi(f0UM#;7Ge>UzpފFT nݚ+5=g>C^zxc=plAd^G# g!840-6FJoethU:J=/VnC_T-ړ.]ə|ʶqǂ"`C=/GONu^r j6,0fEm{. :{Ah|9,zp$vfs7C˲6U7lj .T, 4i\RL>ù|F֚jIAeUrm0=#X6Ծ׵(ʇl۵]-34v6.6%;yg†P)6,\Ih-V5{A%ucqF 9,93x{|o6a.KI%Y:  DKA`0\g]MѾjVzw/9G]LHH,u?7&3?S%QԨqWZڙnk~e{?GƟ3=qKR!(ʠg^F5ޜC5:\HO${gl5qUWڥ1=}Kѻ ]9Kr1svU oeU (x^ŧ2w*sz CdtpݢPede]RtRV'OLirWWXWvVpv8>^ /Ʀ빒K_Hi|I{WGr[3Ʀ9ʊ\;+U*5:]{X땝*WiHgI[ nV &bh{N SCCMVWYAaf4GFCA@xA,XZRVՓ=֠;Bk!AQnXp&y{g# ">P9"eUnǩ'!\C q[V[!!,;WA\ȕK/TFAUz$& BX@ZqE4CnM(\n]k 4_C+zUXazdY꺥xpObGgԎfdև'6  MmLѠX@M$/NLM$X!c ǥh}nP[9@&i!|UuQֿIi/2Гk-(3ߒ9_CrsSFsC魵잟Hϕp(\C[X5vl ws;ñd1!GXw3dKFMN5`{z%-~%>ۙqR8ͥvyA2X?Zht7IPN\Irٔ|3nKJ&Wu؆U 9×#:Ҿr\\7 ]sUe٪[Rz⑹E>lO媳Y\RDhzN:Q,JXugur9K݃reg<, fO+"Y|nuz0B!䣖Ky+'[gK Tc;MżnO2^d͓~E^6Z%ͿiU=K!6ȎHW6â,'Z+ccb<Q\ۻ϶y@MvfyRRk]~9=Jvr@v b]-GrF ?WF9X3j1U36S} Z MwAÁ jL"p B$4{_qS䝧LAMZpB1*+HwLdo GwL[YEb˞ۻl>[fR/~&%$%wA_<^bI$yccypn_71yiThSu}FnTjD L†}^kI9/tŲ6'2c:nqE~6=rt c83A#y&D``T\I'Y|Ps=l@6V()RD0{2B>l+l22׌(CqFC!PDkނ; $yP`rC4{_s;asҔv;Qj\c3NÍ$A|9n.8IkzCtC/NԴGֹӻuuD(봌]6f ",mV_{l&.Vlf1|t +|2mPM&-ԕzwbg&^HBB c? Ca/;*) ?T02F)DH  U?:Օ1d=Wϫ,~N䨥iI2|Uu5psOE>幓 {d3 w)C+cWMA _^SS{k݄8Zh>+f{xS]9?S"׭1Ž&xHgm+zOК ~Ͱ!{#AޮR EN>&Z|NMw2.͜7jHlȊmp6ޅp2ڝ0eo`=Vu˖"Qm8.gytoButimrǂ/>^֘ 8h\W\nS>M/$>u?<`]{ҷE6xx;"ܺ=hɍ. zzť蹌 87[J͚{I CGj!`T֓Gzn?Ł nzlf{6[O&vl阼?م)4OK])BS-$\|ъCY#/ÂB4N~ةRXnVeZ7է*Nl$0U} 7766u8s[tVWf/pcaj\'J2 ?nY*E {%˺xݧ)i[6DIowy*=B{?w)-Ƌh i)- =ISNo?IqfӿZ8fIsV㍝=܍v϶ F>,ks_V%O)5ͨ\NgJܬ.ϛv{7D1nSdӽcm t_N7=s2WDi#Y&9kPu6栬ty3Av:tQ(z>7:>9֝- 'qZWmdNhv~l) ^ rn}͚L?e)V';n]^DՅ:3ݙRnM4Gbƕ3M<KJ.X~}1;㺴~u^$vvo6Z^(|Z|5}m]w|KICR}r)JqzoOZ6? 7%rPaW,n#} 0aAܹa7ZLȧ! sZh'mM9}g=Pqvsrυv})B_Xk!,M"Mv[@G,_bE yF?Y2r#Ɋ*uB})K mۻ{a}yM;& 8F^$zu/]:%L0@&H!0Z} ckDT^u!&@y\C" 0 dƼÚ94<z/a(v>q{(<. P24E"\-Jꥲ!sn/+X0:#jlPGtG]5y7q3%ŕ{[]u. Y: rt#Л_ !m&Duvjhhp[st<8lFLJ64T0cz7Su`9gWړO10j<ҲMߊF9]@fguҊQkZl8&ځfXל f,+sa:浫ݚygVM -ͿNppGuMLCj&{ip)Iyն;}ЏW|x|9ƣGdZޭLXW;~QW]jЗyC>~ ' bB.|:Dp?P9KtNC)÷ÆYy}/YBiÇvFn?8MX@8A DYN7-,ǎ챶QK=gED"$o0=EIWʔY/㢓IF%J#m m&NFzy\CU3䆒J_ӷo4vkj@Ps 7cOMONj;/x"g=s& i;s $wU߶TU~1}*رY{;w^Վ+gkh*5j+]ſ9{3=: Wʲs<=e/?|~&(' `}?Y q 0{ZrN33g & éN{4w5n+ \!Wivve,0ȵi;R8v6ܺu/~]wVZ1 EQS֛S\֫sNJzܺ6ޝl]n-)؟)gks>Gxp}8y3Zu~u$hY/?gc-[dmp +~ ;(%wxaKۙ>qCgVJ>?."_~Go|:O(s i}#NОCl9ՊǕ~\z}ݳӽpL1"Flv0ݯmE$j UZXNtRq; { ;Yۿșܳ>-G{:|'SzFܗp\;Tn]u=xﷵm 4Ϲ=mUfjtySmugA= s-2ɑoʓ21_o-L~n3>iD行L|00sE8d-jr^9^c^[7o"'Á;s‹yzqyi^LWm:s=t3NL٩`1=wWuCY}wAƉS;w;&h#ud[&{ҎjQGayXuncfK}c.;k}籹!WsKv9UR=^Sqn[$G-M^ݝV8.' | cSY/sB}1 #1Mu8ٴm֋פb Jb}Ǽ}װggE\!{4"!錢2.ȉ|[ACG?ZCpzB@} !tM@Zqs7lXzDSxOnژ뜧Rт--z73$xHE T3 8꯳<R\=ڻίk;nf'y\<߲]VS߁: 4Y8(|sdݞޟΒW~w2~ܩ˻Z诓빫V&--swڎnh,suw'O>BAAPGygٿW[Hchӎi'9-ewX"ߜԀY)/X>s $# IòĜT4{jqͲP(!d%df/ :q>jZaW?ޚA=+ B=mKU-(2 0@F 8cKp1a 7t;?GGDEBd ]!@ n$7hS}l"cO#ı 4:{F~S ` 5dE=i|6rOEI_O`;OR&&VO¼*yӶs`1߰`ނ6Us5 ?Gc:dF`^Ȇ4 Y)ɹ^n B/2-y|2`ĀW{j7KK| ]~^Gq;K!|8k'ܸOB!|:y.~?KuNj_4+(ڠ>:nzNpX47!k7=';'jc=6/Rns!ekvO#mLw[l,:ι>DX#zhwl)yNES]smƐdq"!;=C= Y5EC7,*~k+#>i6 E('/.6OPjw17}Ro/_ߦzE"ŝG{є_h$ABB!!1)#JN?Q!]+]@}KY2?/ nL]1Y1SvT t>CޢXI?َ|7J jA}dž G:ɾm@? b*yl5dcRgQu 8~Oh@D" J{hTC$``D}O?e^l )EDKTvgUNt)oy8z6>al_@0ubBi2SUq#PVlp2'1E lؚUɕtg3 8yP!3@_ $3#8xhDHhp0A$L_5훗<&k{06JHlv0<; LÃ^`8ª'YzJUgJ*N+A@NiwŲJ$LsmR %nPu9O;X2IL+_'}%?NQǏ&:Fɯ1T^@ ҳ_'c 2&}0>r 7嵚ӟyLmI93?To7rQ+@(kH!gLR/ڈzG(摶atpH|;g~ 楲 -ӎ0UCч ^:{M_ٙϿ醼˙@ņ7C|{56׸#r|5#8B}ő| :}nu7V*z3x'gGsM~!?R rt#Oy~z=ػoza_eE7%\>'$q>0}-)=Vxk+Yjjܵ$"ÒzLR|̿ɪHQ;E(LdE@Ͱn8򰔴RSI2UFְ)xXCRVVjO]̽M`mF Щ˃R&;N{h6B;9:! J!Zƨ-[F WҹMgC)1nvIi#$5CR$:Etr>7|&ת}޲jllx쳔ܠP%~"`Yp&.֥{x3F)2" q"lNǘMo緋-dbľWs{J z^.n/fOnīlLivx@{n ,2ͺ#`msV0yB:dY)h}/WBO wE'2%F!Êܜ+\,f&[56gp'3Xui㥔6"HtI5nS!EV,K4QO-Z n+cFt>4 ~ZRsdX° HYmR7W$'@/nx0sur JX{a9}Eב<]ˋ;#CrIܐj0䭶d۴%U!Q͊DJe=c%N$/nÏ)} CïC?%nNx;=O_tnL5575xh2׌$gJ Qy0D,cG߬eZecDH4͂iYFU-+r''ԍl8%")N`^ '3cM*L>QwrX&jr{e^4_kmbQX Mz-aX rOs#CSvvIIAo!'א^Z;Ib(>h4lEmbFܢOAg8~AGϨ;fG Ƞ'. "™E5#Wm( k((C?^+)/aa\jH 9jTGe^?QǙ"o:u~f˟Iɩn'"D!!jik)w74a ,sgAepϝpnIE)f64u9^ijl_ e>܉ӉY`/ H݁O9 #qI&Mڒ =QK܉[ղYMխՍ>/T3IJ#N+- Ջ]@fKQ#uoqmaU%xjI!@X܃PyA$)Ӄ2>d{sLA?mjA~ǎȔj=yoM5e #dIP"s]*>E7au]sQs NZ9w^{m'h"Tj -))ϝ 6Vv @.'3% s$Z5'*44| X%Z%Omtt?p@ 7™\j].G~sߎ5_tcBCNNo7D2t q_ZMAiճ+QE,|NL+LON{e9&pj܃=c| @-҄ynRF*/ m-TU;sao:[Ƕd~[`XW]L9W,N [Z82>{ hhtl+eWiARᚉ&\lzaiU`X{_֞v.`o!]nJm~ aNӱn}K zX)-BU]0T·0߃]fJ;6Ұ~T_<>6L`{?!Zu_:./ţ?rS%#\̲:PmDD=ýgvㄶ%8KD U5ċȴ(P[ZE:1_K UZLFӱ&~wBDx)}-4gNs bJ@X+1%>R]xIC@Y.QOc)۫`^ѷ S53򖠧LhB#,ABUlIr,H \nGLȏ-Г!~GkH`m/*^Wϛ́u0K}.ef#u9<4<ޘg*j#VIPF{ d ӯrӍgQ^Xxz'DvH[X jnn[CU+f&+O@$;Cne,Ҩԡ}฿Z0#5TϚZv9w(*.3z 斨B)~weդCfƽ`h$0LDHW"5̌α7 0cl[Gf)afyxrdznޯ:; 9XU5" N:G 3L"abLCdvƹbmJ윑h1 46c<*BG`B&bS%"¨(ӎ 4y3$ 6\U!'iF2|Dܙ9a}DUABfSqfQY(^|?*&i.yhҷ03kr0U?zfJ#alcƟx8d؏pĕr^׳m~Va4L? 2LZ`bc!R_$QSh \$ &!wO!S3I@O!@/(\ :mҢmr5?Cb NT ǣM8DL.52KG(9m 0n*ݺ*.?#TZM(b}-_If4ܛBU}I0̜v6іK}J髦UOڏc-q>⤨N?..)zf&I%rQEH|~_6jp<)LB4ٸS3vlWw["ynTd1 NFkfxwot9v$1V\Mz/q 65V&BSԠ4=r4r^YYoł[^ xɬYXtc]\|@JF r~XEЄB=\kEH^c7HyTiժtI2(tMVs# t2T$ 2JRM_ƕӷǍ07L? ,a1Y&P}827)"׺Uv\#yyC H`uI|%e g_ 6EBnl2# UB=jpF([=G(LJx \?*r➤oiuhҾ8.?UiG:^ܬw7w82R! wvk&4 z) T\D΍fx.٫aXv0I> 2*RҞx!S' :Tysg7 'KKk(rCJpF5*8`v;b;.ďE<%dfV,e"_I L AZ}ɜ=u#a%(иvh8Ӳ!ʗLuV;,UN,ޡS8,%eJzB]vPka^]z5 uSC[8-),fvoqK hNDr-,Upڵ_> ,k*յNӾioZlq4v0UqpgsF5AHu!Z(:h(4ɡm0X02ĨBc J#e{/MP(͞Z" 21喲2Mis[ { ɍŠlMBN.5OmdD4ͩjg]Ly?o/S/jM\H %G_qM4=3r (j QTic*u͝ݷ*dsůNoUixkjBpO.D;a !=4: Ř"M]&5 Mo M'覫 -E"a5j5[$^˪rs_,׉!G(FOKZ3L;Lf0"' RV9`LN|dU>!hH@J?ުzTaVʌ_ ,90Sk;UncIӮQ?%iHkd'og)涪ߛW)J&c|nh4܊D8K}kC*2TS~/& FmTV}Np˝!5gCl5<39J?Bis2T[xZ#3yTEmWJ/E"Kf/xE!?-?\S_d~)fZXQS% U H= /Gzȏ6-JnKKoEHz9Ij@V`jH1 f4[/ .z$4^vC1:wrٙ5/_FTrzN|=s~77ghIogmɪ1Z W.: QhS6;JoIdKX{k]W毲xzͰ,k* {,"fgƈ6WyKͬ)cqG|[Y@]J_SO i3QCa3N~i& 7o7ům6q񌏋vʎE"E*}Wf, }w_{zgt!S?oŻ}uچYLJN̤ă`[5!:e4bF7F.`Q`ˎ1,CeVԏj\SwSe&tl0$wa遡z=h XC/Vkl-6Z@Ԇ:g7hӅ)'=(YC=qNBu K܁0Hէn,ɍmέnۍ:8So''V/VAd Vx-ǝW;|"rS ySn9&Ԛ6- &8XI1HH AIʞH6M:Ӫ8M[JIjN);m̃z,OKwFe Cqiy8kTȠDHm0J[t'L MS8ԜG:O&:/VUP G0^qXNLy *Jjjj(S(J"P0 BZz?սp5׬)L.1ljEx1$bDfy'(@8RFr&ԧ ȳ];(݋2D&@:wGYMG}RI# Hhbqu&L@V4QlXIH~ǷD= 0rN3tT;]PY~)-3Wou6u&{S\My™v,tʆE ذv S0 1ӣ?b0"f'BE[U[#M1Tb́*[s_qE*qRD^ukj?kGJڙ %ckh҆* C D }Ar[)8[Yqyfu|C$ ,!ѧ6ć-ߗs)x5p$*aCןcg~/Sԣ$jB 153yLlXbc9 >+|jJ3\eiem0s30rEPhQ)}{Pecw8͜JO)h&| #( LHF!y ND@" -O7ݭ3qcٕa"!f;8S%#X)xP϶ thK8%L"ayǜR9,~#qq_zl l3<##u 5<\{2c!]ɐ#&xhXĢM'RK>T22 A$VIJLj(hE;sp:|% i $.ןg,SUrliCDUpT5o&1XS&}vąA-Imڴ. ^?RC \ؚo1DҶ5NNf<5 w)6~c/t23S4-*$Ϝ1%^CW-ї Oߒ۱.A,Dh៥u*uywN}3|% ,D֟2`srZR-O)'Eas3=AЮS ̭(y9ʱpaRz٧:6֋-ki774*D׃zTPeRyQ܁Se0WkJ-wܼVe_9ΔJwqJҊ2ХD˂Y (%rpgV:2"^ǂKMBA},}>}6 }|)dX zkW:qF˙pG 46rw՝~J! `UtWS', a5ړ,wӥ|,`0~M q26+i>džrj^XqJUm X$Ж_U; @AYU^זT4JF8%52C&JT6 lXϢ8ɟSRf;%fyŠOJLϷ؇)\e`L9\1Y "ZU\ÚRa~4RghK}4,(qfGؗj\Us0w}1):Y#X! Xy)?nӌޜ=2LͦV\yKRoR@>}-A:SNoa_@'0?D7ˀ`3R0+%e#LtsCjKC6Wt۟ eE.*gM=:1r7o{Oo}_Ou(=b2G$ Y e ̆AuZ&&(0 !o{'>λȋQNtd6feY;,}YsPeY:r44QDe"akX1;QuF# >C U2#  ?nҋ<\q\O2?~Os+Zʾܘ销3DqzZ9j\*RDu M_8nL+;CI]PcVfd傧(x]vO-?WsJ~G@%?9CtYF.u-|dαBn?s|>_쳡 |\s1Gݗ2;9 qi?/[JWW^@9M)V?7c?8?lO0cLMܧmP9hS! 4Ԋ;1mZ":MQ;*uÓz\@C~ i[uX7Gi,y@;bGS{$\Fwџ3X}L]SVf3.0DYF@u{Ov8_Ly{C~8^msq{_tN招1Ȟ ݶZnXrDߍŸl`G:k`lp}d Ah `#6z1x J8ALMTpuv|LvOG.M9YR{5;JpxA q ]ݢ4vY,6޽ÆN͸ wnOPqufw=Vxt]ee?vjshQڏ#"y`Z?ug]`<|CųօgˇɨKOs-9}ڏjn{k򦒓ϸ,}*<ݶZH[_z3,;w^ME! g͎y[pHQKH2._IOGvQͻ+YїRAac04ػt@'X #`x 3n"عƱ.2`UA= h@6UOsvO=g+gj6!׹eBv_`uD4ťs *x6e ^-`s~qo1Kۖ-m-u[տDI۴*:1P0#۪h2;/` thcD!t 42a WTJ&ոvKkc>錣^I5rB"\Nf!gY t|Xt.Y߾žYWP1~k|ZAL)۟bmz409v༏j=Eכ0 I=Qy,mBs;I'%F4ya4O'LDvЍez ]5+|'4ۿ-Ɵ+3EmCmxJմ?`[@to?}ab7ݖdLyݷZUm])k{QX<]$Ӈ=y4]3lE̍VyU@.}ƛ2oXv;6zqܳ( 04MD"%p!je::Fe e5M|Sty'+]}#$z&rᷦ|6fi|8[_6 #+*$im2F:8)'L$K^64>dxr.ݨ˧-J qLuY]FrJN֞ΎwAscypUТ3A|a}Xyg]'K_/'iiL(eY髷re ӈUE Q{=~ vTOMֲhr`}Z-Iszqz qx[5moJ~Kctv426; =~&֐p^G%”~}{^mR_uc}eNH6ߨJH:~X:=`6[̳W1byJ" S FGwWV!kj1E R)kp|7s{kB򾎛[]+mV9@ rnS(?or 22 æ/ѢN+yxjJh gG[&I-?.zWlbQ6P6}D|8:\phf'нS\ oi^1˱@:@f){VRSv2hE ,3|UPG\Bb0Y\ԴE]|RyM#t,a@t#[7J޹p-] :bi>7n4gg8XُN~v1)0ܘ"t̅"֋VG#Qf53OE|dQ'f^ݚ..̹F kmr\|VRTDI hAl #Uw94PDUgEliMHr. 4'Cɖ?w7 `M%3{ɁHڒQYhbJhoqnnn"хt''Rf8]n#} Û]>w!Z۷Zjo,c?[M:X޻[݉}1ojPWٖ+kLޗgo*{עϮ~ Wu*ܦ7/n]fc^j7pnt:q&E>#]~t2lQg;ah[Ќ*$ShMr8JC I@YtP÷?%qƹ,wTisG.KeI~{.5_o,{2(4+M_:ݿ1Z;Y3VlU7ݝN=ǪIht)2k<^U wy-oqnnp3NB*>7^]w?ǽi&_õZ{s.vSѬHQE `&|E o]&uYۺm.+}B歳}T,χ!ŜF"% Q1!#m ThȒŲYRc2() YZ{X*>l>ހRh(گk6 E JJ6HJ1fШѻMQme P)ldb%% )QS6Q*!h @(BW5"3FKPlR-RQksY PD)E2Xrkh"hbLŔ1A븲՞y¤76HT2FIg"pE屜~%pH/ދB;gSqyG:Dj]ےt X̐%.VJ3m㘶*mN5f&ak0GxhCɣnu♨6,RԴl6{Oڴ?>TV tmرb(ACҩmk-dBP n!#P *sL I!F*"@ƘCChlnbP[lcBBJ @_/jN $&7K&hJ.-Q]@10C,*lGMƍ&HIb d$df"rruҘS*LhmՌȐg nΌT='y_n)ݳګsN.wcsz>"T$稿܉zbwqP:/3>վ3pw}:u.;].zLop)8~[81V3:s訆=ev|DERN%ə0WU:G" zѽֽVUYÛ4/>VRp7y3B\@׭b+)ݴgYqD݄)ƶ<}{meYN6 W^ߺކm0>wy>>[}꿰Ҁ(p$Wu0<ƻ~-oկ3'p1m>z~?؄:X~);䟟z:feɞ2C>\VP3>*s})yQTa:oi_=Q[un849"@”d2%q9Ҳiݚ-iއnY2oIl,m7=_ɳGF;6Z߅t| =d qy 1eno8'w5w܃׶v s>$9-G o'6$DtD~ЃپK'둔3F `c1< W:=ePERxj/Š!.%pl6= q>?lKlr0='=1h c,xy&nSce AMD|F%kQCxvx4X\hD>)]҄%N h۴X`q_~0>22=mpmHQ[\HR͊ѝ輸T#Paʰ-{υ`@EX<'I$:D@K7dv_yŽNU3;i43xIhWGŠA^$] ( T$¦B"y2wɝESE7Di(d~Q0T:DɴV=MBd[r&kb KS*~"aqZA9QKGt./s&wӋ!R&Wʛ:l-KIuPo]MjCMKB#uZ3w.D8~5eLx.O~g_V-&J,M L_hҭjv9aİlZȓ# VWm'# LBaϡ@CDDz*#`GMgIX0hm){@Zz$=pr`:g*r6ouَqy(I7$Ї!6E4"& !v\G1z|$tV?U|[2ZJ69kj3`C]ŠW#;z 4OAUMo)W8H7k*Xd]o 7cO񅇽_k?Z$7YB_9g1 ti*0õX5L1B c=AH2AϖP<+ba."U|uoBoH)#9Ӎ~.Dk4 ;T16Xslbd4]~?ٕ~Sz.m@ hԘCYRy$n9˛[-pOIjI;hHd2-ѧ^;IF@"}y 7!e,o'Ա=_~RO1FC|ER:¹ a8E { Rt-3-찄t~+<6]?jűEʋWFMrr>)7pﳛ*e:JG@tW0W!٣yʻhL"):d~aVvͼ8G']+'#iūUQE悚~|QP%,o¤< c#.V;k  ǚ:i$ >M^:Y,5/Anf昘32MU9"",;wZm,|k4i fʶ31Tvډudձ5@7<'O_6xh/@Fg8f$t46tØ߲ѯdo^Ɲ/Kn np3+˿WBiw {$Dye0~ 2"́>,/jYí--RdT_}S! .ȤG2/gznѩҧ7Č%C00O>kOhnBsomp߿|~\CG\# C /D*{ZgDNP,G޿;#uODp:y|:r.t M_/3 $dK.A$UY׳rt Hd?ߡ:ғ lBmaYa_$ܝJIƢl(9 ! Qczљa^-U# !V \oœ_ywS&]|G񊶟2_jOV7>!,L"dlfj`r'D 8q1Hí֦jR_`=s~'DiBKr˟(Ƿ!Kqr99*N,hOB)ɧjȨ_¹/tā]6*sZknz #iByPAg6pg@g❶nlrobj§v˸t7f[4ЃQi- gnrA~r,)T `\f0ȨIDD;4?Pl2㢕J=H(,GQ$ NSq BƂ0el;3m_3omu؛UHKblguv[v묦)+`(,JYmڃIT<>C]Mž_Fܽ'M۞|҉psaWi,b`dT.-#ۯF`xã>_2pM 2aCN"*hT)j73F>6=؞o$)m7R;hW4mDWX=vQ Xj'6"'()-`JGE^ 32CNw/cE!waK/B5$eo_d `hb$6$&!-Z3JJ !D(* C"3Pq{-iԋO.%bU:ѭ\^+ά1dZ?j'I$4=bf27?a `QS6!fC4F$dEX2ldg=CɮgU$!j:?d cӠH(O%jd.ܔ ^ْ7F8}%cPA%x qj! nr( O|R֙󍨕Db"YmO/N)?~«EbZ@9tY8r@Qfx_ >;k1 H0*{fR*ڡGV٫mCD_N2ݐ$8Öw>VP>+!U;@۱l"UN= bȀ- Ϩ~C8>wd8-h)"0og `s= y:'At~?S`H6,OP8Æ!Pr8R8ڝ~Ce(y 0$H3JV'ݫq*}f(3 t&j3Ɂ[kC{Rݚ Ev'aKK<նUs⠹{GÚ@|%J2h H;p[>m7U*F]2尽(ErQWā>br*P`@^mL-@|que0'ᱡw`a>?/s^Ga~T1 -AOD#/e)YR:-9Yn0FGԟEZƗe+0{_#x=B)Cw J#}`?X6A)k@3Vڈ03 @vrvCuW >L7t;\,oGjA|L/U^0Gvt]˳Bf`~uʂ).ʰ$q`# )Db$Dб 2D J琁hK׹v;aOZZNP1Nɣz[OX>Q`W152WKZ|O6|z~I*d` Jϖ^3s$ dԨB j.߫Xy|V?FwBT3NnJ0wk^5~s]bscYG^[Lݺ4;l)Y۷tQ &v{nqhN oXkL>ժ'}0,cn+υj8-'@uqَؚsBrhzabxLVgHr} Ԕ<ڶ?߭CGqqqWJ|aZ\N`˒KbD?'mF{B ]^xu03*S~86;L~#ƎBr"\/Y /* {sa]q0~jٕ*œanahJMhЙ+K*Jo~Cc9}&R.?4n\*L2g??OX!zRS :cu@s j[*d ?9Keױ|ͯcdy#rmӍ?/e\ `7 woqB7 2$b}C!On7hi>eL`~۳V{x︙kl{ Bܘ '׳V 'ҟW~]Mq5}>s$ݺ;o1;SG:?}j];MUPC[""{7过i" vSim]7p&IUDf6\ Y'_ ?.6@7hO/ )V$5UM)E&C͔D7+#BҀJ)j-m $Dڍj5!QJ"b 0Dcj7EFͬ`0F1$0 0ēL0c(%%)f&20 IF(3dL4lhfг,B`IFkTj)4Ȩl 0 ؛U\HeRT!BX%16.E40&'7M%1#23DYLH 2bԄh)&0PIRR[3LDeTIwm Bbh1)$[& βFJh0 JwnJ(vK$kURiZT2Q\QDrɋmkU[RL(+jhD,JK5kdVb7\2%YiTyUCzk k5oJQnVktծXQsjbkF55wQX*$ #H@ dҠdЉ@K@% I#/*R\ܠAƠ@҈Rz PtH HR2gmye8ocstB ^ f8vEh2'=ya#?yפOSiZגAA޹yʶ*~6c#~E^MwamMcDue[fz̿w _ߕ4>u c]\0}+l#tt &r;C2.xth\.ۭUog~۷N泃*W7IUVv"r=U`^5^7쟡(v_;7i ?;Xuyq`vEN)H1= ""3"pn[p{~ȇR|/~՝_}= "HIΘ@쪁 H<ޥG|/ث2=z ^Ecwvl]o&"½"!au OnHGǚ!_nJh)9ޚrBu -ӏ6[LĘy"ۘ YetldpDBXgGJ'ȉfo+J? 9c@[m g:@a:Xmr2` 8Z'w#=wH[#r0B WȂ k]cK F0rNe~gYKegär1I_G3d$y%cHv1t_4O m,Pbq ̞. $1,0IDBiaVEQxQ"LlE2iB)( T(r"dq*sj*%dץU(@'2P)_aW .k"om3&noɑrpkP'Eg;qo]8KAI !lrU] -Iޖr0c07_Siˮ}_3_CIdfV 4C{a1ZX9pˋ7:7~o_+PHO/5Blȭ2ëpeۣ^!DFؼ;Nʾ;zLלX0!|$ɐCh~`U$: iSpAiYU͋b5VAΘLQ@ɩVQ$'?S2iPVAF6m΍A&aiOx_ 8#NoiRԝUU<ju˛;]y)LEWs<Cj#"x/QXSO> Y'nܷ;BI]Z[2}cxiXPk?g颜ۍv;N$0B|X"@qa2`c? Rf;"ƙ=u"`']vV#%;o L4ݯ'R!fim0jm_ƠZ@֣icDobLHrTe#~}!IĈy?xT=k,ޡeS^qũO>5"!,|X&ODx5nP{sjι wCL8,R?Z";tsdGG wz&@XŏoN3 JH$%0<;kNk0>|W3 jgW W̏b] rF ,#99mtx|&Q!6V6"MY@myU'l .Oƭ7.S XzfEc4ΊZBW]fw]ti;O lp{/&y mG78eE>p`[ennK޼H&rYX6i*~|\v̛:`~VCPaUGw w$e7 ƥ ȈW.fjOA`tt(;<~O/ <@aHI ,݇pvY:J@E56.WBsoNxw^Ds/lEJ$(袊yrgVx ޟ܃f*{ 8 'h^C2ly_!a6P͛E3n3X}K]^1{}080"0J4C Sb59:dOv$s`B jS  a{L2I L >z(x4ӎ\򁦃0]P|kme?Q^,r{enՏxR1{T ˑr`/qwSߛ|.]Q=[]Mq뢆9g:\&:0vM z&tQ"PUM ԡ|.7@ŋT TAj g"TtȁdO3)+y{c]1u=u`\ ~\^.J獭BtZ=-C2jKpCd,a4vrH-jeBJ@±J𒏲 riCɜIx~]z whצ0!R# .t_s8誅<ڝQeὌNFy.p Z^v =?tx=mm6cʛL;=)ň~l! "`e@E|ȈҞZ ,T":Eh4}Мu'[fW tZ5TJ2l/@%1Am1>  BHl<ǽJ LMbgla6w-`l\AWqەja_{m#MBSb=|+uD&JJn-\0X@gMN:ՙ&|0"&r=hwކشmD<6,n-d{FDT2#x7Ny%.i[ fZD `}VOog7^ N8U"ևdc3gӦ e&NC ADR AaQ  I"dJVm Hg 7f lF޽ .]s']ZH!xdKһ@@RB~5i' @)n5;ݞ5\|oK%xKu3cL[Wx_BZ}h$^u,#c̡kzq-U뫾/Gǧp]&#p0hac S!PZ+K}MF!ӈf =^lI7L2&Yפt8eHNFsx3~x4Hh,ӻJM$ ?ǎH bM`@-Ϫ @ sVcB <-0D>k#]sg0eM Wt90;DWlв}[9f5yyqLb6ImTszz!iܵyqw!)7MBTR8N~ua%& F3PLqv"B nc P-%7R- 6qL0A tI=}?.?LcջhZ`_ix{3=8"WcbkU },->H=TliݴKw*pP8Am[7-(*%U*W_Q?zz#>ǼG?7AyVfp,٨tƟPd9 a=}eq4+-d?9+$6f(2m,Jv:r%\gԖv{SSqq|}?"L-z6fqo-mpք[j4|טzyخ$ 0I \GB3@fLeAdnrs4ob_zNtP/NcUX"9aF\-WZ[a |ȻE??\3U u?|g~/z񼐘ÿJKUcQd*B} fà_`I6 M :{bݓ m2!X;8&I: D!`8b3$E TJ!u紙ఠÖ)O:b5$OL >txMʀ/G)w:B"I\Cl|[`?K_8TW>O~pFEc"j,t]A 3, 'rӨXc۸7Frm=RCNP<^@<ߔHY$%:MLܠd$/$k!; #5)9Ge@6HiƬc_Ia$BF[%U{,ӞC[@`In04+X[a"0 3AfW)2MYdB 4!D$vqfcS@v!W&pMaS'@.yK9oYш=H׵(0"C?DAOOml8Q HԸ:Nl'%ֵa.҇O;'Zς]ufm-_B7&yZ2/nD*[3|d;wvgvZoN)5B~5~c5k_S߷y^7LzMqfܷsr1̀|y4uenLiMn0`2[k's40:٭=.=?&%FlY/v~gu叆Lנ¾VzETb(ut'tbp9?o8NG@,>> ޠAGV@e7dQ(ItyMaG7OL1J"}5סHH1,9)Mm5~.czc_$wˢ6mpۮ|߃捊s,j>.?~8nѺ`畵6ט-_dgL]Y|qwnʳY;KWȭQa;zq\gܵ 6 nϟ+8mTt=_}XWvL-#x~5~K+%7~6(:E8#\2­\ah~ ]ŞW"a h,~\Rٗ 3F7S5.BE -hV݀nՒ߹y5kۑqoR߀ms_tN:3Ynm9岻b?Uw%$k_lOy?3ChVv8q;ռޡѷVFPk^uV< zǻ g~r!FTꢶ,G.ŷK 0g@rMŕ FZ~񱋅KA)ZuHA ocDYX0`e5OZcH3'l6[9.[lsN[/ EF$Z0xs~'Rvyl&Ta4 Ox7{C pBW\Y"LlK&V?ؤ8 ۿ )<epƀ7n7IiJ~{ Li,E! bȯb"( .~w?G2Sg˥!|tL@DXAkR9+Kk-}tϝ ݉ھj+>w)a7cbEq$ `DHX0#2)Ac($|722^a:ʌZ'=>s ]R훤өE1׎ ,(2 F\Yi5 nfMMdJ(KǏ昨{BqYQP[3HmG;iN$$XZ"h ĢĤ 2%$¥˳N8S͢~.E a=ԒƳ\%O&Eb9`b7bdc~fbdTE R}}&H #bHɌAH,׉$$L?207-Ip$@ENPH X䛄}5QӤ^ܐ;$asBkM)LZO+Em뮑bSwe;wLV(,*S~:e? h!hDDTm]W͘]Ja׼"CBGxCCEGN]> FyEKytKӎ 7oHI@AZ**G9 8 [ARt[I2uuL& aG-&d4,Hf`(R#4@<3)UQχ ߘM]My=ׅ1y}<2b̄W/lVώ Юm_wh\q;v+ڼX;f]>6[t5q͉׍s v^/~y'le?q\g )`Tɭ.m~ <[mS-{͊ő3 |׆!+V1`$)8 "-cP@ރuThP}~_G233 ӟ| @ڔfh:5>x}}a^g}ݟno#>J!ǽ8}3U mUP͗sz vJ)ـ@H wwXBysvؑ^;cCo`42fF}d[ ejݺ? [Q;n!`]zI\06A*e8u" *{)CßMI_H ]]P/0+ їať۲ħ j<&E ?DVGKp2I `:ڤv~Jhn Lj Vm CO͢:C^yl͓(Uo${ Cxӗ C[`5gĸu~'Zp! ]D ;;IۑYؽ1+Ztk֏!x/$pKX]Y0#x2$$D0 ϨA >Ք 3iDNQsx)^ټY7jRBBSf({E* =D03}ɽvwp_jJR nvS0c㠿tc0 \3+)3+X5n]<4`?qqMwC7y]+"ŕvh6MʲwxSZ 9@wT$q@ B=g:JAecjs*8+aɩq4B8ܤ&dB B'WLul[u RxL(IS hXYy7yu$jazxg,HSccYb |{Nt<̹;23ʋWUL7WZGySmإp؈"$.M9 8"bbr_O9H gb3*@#|lNOHΛ/iۊ< I[GQwqoòlaauG{3;K'z /wfwJOazB}L0:`F-̫QfUe_YŽV/QSiT +,~N?y.ӥ :ds?+10|o.&q'W5"=OԄr8|-GH3e}|i$0\o RԀ+*,x쥉0tU6I@~ʕLheJW%!~2WHPJ4`L<>[8?\D`W!)'h+3yxϫu1Q4bnZlûku[C$dlUys e; I3 t5y'vq_ 3Z&әa+S`bg% 5/wҗl}1gY)OAcka[:K[m1xajb_od4yG ïyNo\wu_xA5)nGfZp˔<[K9Q̣֔&hiA/=TV4S>+f1m^Q~Gٍ^]>; CxbDp~穼xFM==1cRO6^0#{e`vBߵc ki]jFw f1tXxh%$Ͽ `>ZEG8 l f}*^^HaX7qtVhHO 4`0H i\Jv@j8|+^m4&D}3 I.NEf*^W!v"u݊=@ U4]!jЀ 2o]-+_8C޸-Z<3^z/50AmtIcB&)թ¤Qx }G=#QPQ75└\FS6 Zc:w6jKSD,ڂfh5 ZUHS|XnQEAejdPb5ֈf7uA)5Ϯ@THO$Zr0 ǝv;4 @[O!.0_)1XoyJ+ 782ŷX%϶56Q蔭L*Ls,sN F4j"8B!O3 W\ sg 56 p$U"#< N}f}LXk;;TjS)gV\VI|=pV5&b@*ޡk&G-;S~#"jSNV9-]VFrN!]nl P%ڳ[ע,m%JfUhTِ em:#[4tğӈk2.&7ڷ+ _ 6O'^&y%4Hixʤ}I! $M4_פI_{WaV[x!ڈm}CL特jX$>ZrlnbՂtRmGк ڢԛp0saByTiČ!q4oyV;3yiLc+{CcAEA CBH?`U{nb'ј O1j>&!'1?Gai'HhiGaQ2@=^@H쀍[S0K_; ;3,q3 <9*p&K}䠬0]Z%A'[#Zmõ-NpUJ f96IfToKF~ d SW`mB  ;,8tT~֣LI[ssP)ܨv$p1Ԭ# WXp+(=c,<ʂJƑ2ٖv踰;W~|;-kjNf(R[gB5^;x&'a hYʔE ^ztSHVēu0$_k"ZM'UWDk0f*CUn-Y5Ҭ})W?R@ʳ8J+ (ݴ Z\nFӾ"v>UcB۸vp%NX.v@\! Geҗxunm߂M&lTv#@K1jQ۶Tk0H $Ś@[i#&qeqNQ",5 %1i]md,!Gْ?nOEOSٓ6mJBd*|K=$j$*M}3ӓhH+AXrZ-kFCvC':Dz{?z5iu KLv' {ǮkXQKc\Z#gE:?h@3ɋy.jWRb&:uuxaZ:9Ǡ{[5ͣYyɡzkl?3O1F?kЈshȂz49-B#z =J 1LћcE/E|q{JFB` }H00g=X.5I1}^ۻRE Mփ*UhWXʞɼLQpƲi+y whYێPv~2 KL5P֩_o%dZ(UYg{ze<$1mmI(i0ݫ1{?ض./$EN.FW.>3,D _ICӋ'=ҨvҶKwYG Q0'݋|(7gqe;b?{Rϻh,=?ލBئ_ȳj |Kåe~:e7D),N& L8Md08C|'lDƠY^ *23Š@b6=|xc6o8ɜr?pn;5 d h i>!p}EZ{&ZUYQ vAޚ c5֘o+Ld6eӁk̪NGE@Lved}$Λw}Y:)d5Ĉ$X#4f1|"rbtkm}|NFF*\{4pBu`'2?\ ԣԤy~?\<=]ce +n_DB j^x~~Z\ogbjc9?Jnr̂M~y'ek"e.u.1*(:I?EPF[?[gUX>mܔ߽]2I3p* F.Jm )_K w6HM=\SB%E_'6S }V G|(0?fHw4bsn@(H3B>40qVa׉Tr>X: ]PZr^Fgpm_R* 5ՠj/Y~KP(B'_V6e@$رs!pmN$E jXF1oE"ROjB%Fp(jMMy)|o;LCz@CWI%{F:lg&mU^OLJ 18w?Fgk1t> [FL_~NS1ZZ#<.ģPQU=æ嬇3w_p9^A0߆b>^y mKEbG(Ge+567˿2߹=}*oT@73 𚢂튺tAnGgbyD3 P[ܾČ~$}aBH*iVPYP['7S*m:i_%/^vDØ.q} (N;i\= ݿ=ne<+QAgw>Jmɣj%hwiˬܭ &H /5o"Z[M*kZ1r޸W} #,=IQvokt6i=`\otz]^FA0>jIF\#@h%$1 ;h`>Ѿ5}Ȝk#@1G+%NVkuw$H[`Z_rʎwrF:=͸".-16%!i} ~ &i$*Dy~DRu 6?_$Jjoݹ۶ x K39VݶΞf-4+"̋t.9x+&lَ.0ni^ʿ]-I"iXӘohX%Rӷ_E1) _7m`ԃA\Q-Eh|YuuSM3a/7 FBU{ۻc .Խ#G݄eDv`=DMEߌ^/qw b9hG e1ou}>i2*Eόm9v' w3of7aey;WRsKY[cDCIN5@4\D\ ί 'd\9pq},/ lz]|#@Ǖd]tjLKn`k|i~Cy6\'zb3le1Fyl=FU /%q=P|AeRNKCfn5]eM#WC3`^ |[ɩRܗdտ6@ DV ?j~M ӰfB}'^gJ/Z}}0xO/۞6$~(T('\>1]K{)gi>Fb d\U\7Q4zgDHG@h`+ڵ(ݛr؟su\g7ð1s;-,SnCqkQ,hW0'4V#Pq% Xe,aO;t xcN%3D`6ޤ7=r,:UjqZ($`GaC[,Yܓ k0wE|D{gB-,6, %t)UsLgqæ=:ўt; O,E2o./`-DSVKΥl*:}5#WErqM/m !Hq\p(yxg_ve "gӃ0h1J5;e =!_ĀՃ[󘦫Y5Ө9\J¼8)6GQ'­ mk޷_zo ׶eN5؄ ;b3|ߊ4BO;':|SUTى[I~=A.ziDFrQqXFɱM[62JEI&jVQ, HΖNe.g˸c~"|hjZ(T-#I_1m%鸭Juz0xw?n["# M#l2"^gM 8])IEq-a*>d4}Od]cKiWP;y dzRlo Y}5I غzmNe5t76ޏRY3Wm>9%M2  z;k(2zǍ~E6Y:w8|}ucuBFAH˒Hb梎> T!!7 5 eOIB[cŬQh)?~yjf#+<4o,zbQp mN8R5hbi}퐩RĵLnv bLWYL*fT7[e`P_kcn_Fc.DC=$ZJ/+לά? {9K$-~ . Yvg5ʴEY99M0UbNB3:j-R\X/kSi^mćp>Yg>~ŮCs87#7k’n„qxWگ9V}U$sf3񌐘R= V2<3G=SXl{{*$OVۚiɪ"f^VSf^o" 5@J*:9ϩ:ȖK5Toc!BVt]%^ˍrRjgVj`є["z#/VeO/H~\Jhf}'"}p[tF9$= bb,l2͢V\Ň=@U#| .v$T,? yw[/{p4R8Ξk?jȟ/(8[, q'ϊdû@<,fMrWLT ;fʘ P>Ą\~}񁛅 b>ĕ|Eh6ݐwz`ۋ/b+yltvŜ fE+ݚ.^ܞSXMr+0YPs؁BȷBj|^&$T1Τp K"vt13f*y WB9_R3gv}2 CVa3̼ՎY}tKェR!*hQU mKXۈUǽaFi5 ae%-R PqʮMǪs-n-5bK9H۟2Ec,hHѸLeQ5Z9pQJ7e7j޶=&Sa\V};ebD EZoQC?АXTwQhq3\0o6jO&2-q(dj;U e,B0LgFFs@0Je*Nʥ0W~~!Pf@ZȬ°4LpDLZ>;۬t]>f/PlscNؤUE0 'B@Gҏo1Oj _E0[x^PovUP\YFw}nAW]}ϱ˞jک{w? RF|_xtl\o,23\t Oh'JM.kWetY6c.RB||%*yǦ JRy&>嚶 HL}!Hrd$&G>Rp2v'V(?#]:/aUS?E !A-7JǤA%`„* I% ق&Tu`q7a.9do6\x@ieR Eo{Hj/`jQx\ |I=begXQǾjQ4;3v$nR xD\NxIJK0vv \]iߣ 럌,Vax|]L:ǡ׊}} q`~\ƙrH\H46RnյZ@i3 -~qdjB&E-Nߦa/,i X@ZNJQdflAY,'zG[e"3`1&~}REr="4>qx}lHt=jxn(^.zgE 4 e$9Yz>s`WXe87g#VЙ&rT&Yy,ojb1Ya 0 *z)> cTලPu9ۤꇟGb}+Dh= 9F _߆۾-Exgϙ {0~\lWOr+/,pu%'abn훿TԎrdE 2,%A"g2l5*X#{%㿫-9prǕ@h˅q!=~4ң&j.hJ q\%t "I"aήsp}k)V fép}-5`gh])h_n鼙F ,\ЋeYL{ǃWOک`4&D6V6dnjO9~yjJHdrh!)1S_H}Qc[h~v.ۜ~HNmnWw N#58g\V"\㰤m5((XMƄo|]J%l J1 *#\=F~צmOWj;TXB*Jq)m]ԓ:cV30H)W.ÚI(Ą>%M[v L*KYTTsĺ@4jRlAk5vMx6HcVsd!~pC@|?#*[Bhdd`˿Z-gٿ* :V~q{⪏ 8bDhfMW0v볔a1ǣ9j9G=1n"Jx>2HM3 j(Ƴ1WuS[בK륍l*76_:-c[pxq(vʾ6EbRI*+<1]&u5qEz p!$H(TiUS朸Ŷǂ0HwА'Iz/ y~q l/w=<#T, <7ȰζҀH:h#9J (q=tv{G֡,^Fʖ'O\I/q[6-EossƉ 33D{XP9$yҞ8-]e+3E J܀ S-!.\){= E'gNP#1q$AWlsK*"^Ac{u4LpqGc @̧9(%gRp- F߆ܾÈUzHz)hX~lvry/΀>q ;S@zpZK}R%,j5,HKͬUtb8 Dmn ,H#ܖN]H"aKV,\B JWUʮYO@ZҜԢg='g\=J~+1wORNzlr]M{ԓ~a|GP+#1L|߼nOJ62</L\nyf(?9WTQDRB^5|DRl,Kzb xEWq*`޵-zL5~7A9v@uLE(%֟ZM~/1 VT(f aj>u:AUn>0x.=1<٣έA8{8 >4 o)9j[ByI61 UvSᐋ[ǭҫtL*Q Q?+h FzZBmG<\莡?϶gRgmB|_ՅTm9J$L‰qcC+]uF_'BPXS<`K,j"ְ^0mO|iqlPz97Z,EfΥ*TZ^ WΑ9?3꣝/;V~NW*29+7$^5hGu=Ypo;ɞkC{ SL>_xA6%J>`+爂@sMťfGj X%5 _igyfb+B-FZ+%`Er#N lz: YnGkIWYrE|ZZ!Vq?]B,*ykH^eA8}2azTvGw& \;^kpsO)8ehhW۲FҥUBb# r6[ߺsp[l" (BJL3ܘ[yYdzn+m0 >a>cb\cE4B4iz3o{RX <$Yy+l'u *ʊ0+rq%,}$`-hztD_1cu%еHzd9C"LVKeKHǻ^ [7)&/fXiINr1_ FwArۺ^֫0^kVƀmNvϢ3"p& ap3SV>.ν)% SJ4*J /(Xuʇe3CFct-u_&)x6MSD%Me p;&"`}`4DS{h4Θrs"ܼy(;[&[]Ug$ы*rȨ֨Aa܍qmχzWV}Ap^ʚ پs52krxft'ز !ҷb3CBaH4)+;f<ϐ2.M;]KyૐAhX*d'7tr PMtF˄ՉynYZT47zLYT?@=W$©,*zͅ%RPi5D\Y,,ɝ1V6$n SUkVGئ[k CŮw HXiM>cITI7k/QeV ɱ#W oF7Co!Hn\$6u|&KV)x1E=.s&d8vW}-]ε82_G |g>PxޯȜgONd-N|9;zUX)90cW3%.M+%(Xi˽[>fN)x}rǠғ Y %䚿05 `"~og~CԿat?νhQ<yo[ l:" ٟ8S"Ggh~[J L4X .p5MbU|.>Zr97A!ͳVwzT9B/EmQ$c`*]Px$ NfPK#vmbjwH>ӍgI̋jFLNMOn/nF$P/]X}`u{g]>tsC}d Iֹ}I­ 6JPCi/ IKEpD̊D*^t=]rt_ BoE3Rbv,_6' g.3͟\(ŝy䭆ܦ)va6t!`č5$E4ѝ,Z?٥W5>g0sRI1}/dFV[k2i% ̄_POfz;APD>RYA5Rӎ'"uvs0mRVȡF$ÍbȴiqՈW'|!xgڥ ׿\ OR3B7I h>gǐSj+MVM-.G>"@6K[M{b3%SZ462h$=o!c1yjsk" 7#KcX6(Bp= -$N{W=ƭTtWEVi56ȥ!{]e}=2~bR2ji(%kx]شOhSw7 [FAW?ŗa$_FV+ I|ۗ!Wr q 5`tJ/,ǶCP!lJ|VN g5-W.mqŦ 8H.QUuh|rEd𐺕9q fTWXZUKpQ 5?_WX_XݶКh5/<*Ƅ* :Z},Ld4[?9s&43E(鮊wK X~_I䈐qi[z2 'a0\TSh;f/ﳦl'*:~-@M[~|5 {*h$nq])ҕSɭN㇑̛` J'(~5eEO)>E\;G/B/G8BE鼜0=C|Rp7mE$=Jadd9 l d4F8M#<?@mJt#PFeG3ܪ]]O_ -ȼ!:HX 29"uIQB}`#v=7AB"|P3#[/q4&y˺ ztqF2@{EcGnv j_8XnsySn6Za('~ Y9T9a&2*{UA.so"ٲ2\ n"lzf?k`54] ؽ*]Z١41*]J[c]4hd.zٯO=)7m742e%F0)s]J_p&_f713l!Ę|'q2VgE'J%M7mTo#Z~3gU`5d)gOfT vhu'ιC<ʘ4=<2sV{GuRُJ̤Q'~}ęӻ6;[66v0iQ}Vo3? K"!DbjI)fTVO5wsk157RwVh-)Cc3 qeaQGьUhb 0c&I];ѽ&B"QͶ8:3 yg(Mt&;YTb{끬U,~Rxc: mVBt^bC,zwBXka*Lk{jۮGcUv FY􀅭66or bu ĄdKMTR5 T5}J] YŲqKp.PfS<ntd{{Jzp7ROl%KT0:AxC"zW H0;m%o %;M{? ,GF^Y+*w n?Ӂ"Ƒ4S+PN|#A6xcdȽ҉Jp uY"ijp-;g, I">rºDHiA{ 7ý&*$,}=F7i]"^UzNKnA _同H#&NqVt. u/e9f~Tۉ:LBKy6P&J]j(rXq>wn86vSqs>4YX̯AH0IQ!¡!u ~._mo~`}VPҰujf 0Y~"]D"dsԃT_;A;!Ry5"ۚwX݉Y+_>eGBZw{qWE)Z;揔KX^bł ̖q XM.6 RS6A.bzƊD 9jD5t5,aYua*ťU@G1{P saK1܊Eʧ/$hJPϱggѸ~U%\yӿ)=_Y~;p9tJ5Z) <>8cxzBp%sl7ŋQ@>;8jULM>w2컆XQq8 [*Hdfr =tyL0*@~i3B. ܖi pm;@#&ʼk,R)4 v CZ=C2a:r-:5?_[@T!;F^rTc"֤)2ɱlnJZIƻFF{o۾0{!3f0ahN$4+p<_SQeT;{7rrY%`GÉO_v3@GZGcVHq m x,K+gMTZ'7 yz]S5xrΜ{61)>Bjם8nbuܖkm%JJ<_v 5$ISC ZY5ưUH<~x4HxsWFh-i ;^pH1d#(:DT`G8._kp0co-Р3 dL0^\A_EQ'vB| k(%S-?N MH柋-%pջ$B5Ա_fSkO&_JpDip~{@XhQpڈ;\,"T/~Z"M*WE}#!4 y;ἰH'DxS/2n{p CUUPVi$<]KO7`}\hatk(Mxn*P4 tK-5nƯ-&\pAx\eb7CƳ J:l2U ɼBRJ@lc ;3gR;?Oآꬿ2f / D~tl#OAnvoMkpU8zFuCF}im\gC}J\J.+TKקN\ MM8'49We JN4쇝iG #0B/ԎVJWD0{;djN |1XE%u"MVn~?zr ƴR|5bk_v}Mm2!,vLN|]1G5FUh~rR cA2*~4: Z; 6aR`c,p;TZO`'l+)9@J2zu+n . 1ӷŞ8ُ8-(?2֟vU3_m%aR`)jև1R|-3#/ їR4T2pڬ@duNOC86pICO( 6 =e3 b>'2َR i _ |cyKޱd␣A5jK' - p˚(iW $P][_fG=P^xT$c͛S$B@"hjCЫVI0-+'m˒t׀pG>YK4o,B|l-Dm$E XxpkSʯ+IIuRBj@2Tn2zT,^wz\}}$O '[ԬMn3ڇHu#lhfn.qMARR5o[rh@\aԙt ]g\ ܪN<<˛童́iJ_ 2(b#S5*(x?zG=THG,4 aikJA'|W4cāsfCc4֕<(㛠}6ܧ&O苏z4`PjC.tҺ{VuGͬ+d~7`ɖg/L6 M5kexz7*ڂC}X -,i)#f|03<. Spt>S RO}9dTrbp*nY&wsO {m:itki.? zu::0&>R + wšwCY1hQs(2|/:V^&t/ tʂEG%%h5%j=vfU}uWB={ϜRtWT@>cd8ԕDz=OdQSbh*%uo5Ņȵ085R"#MK━SXo:'$.yfA_FK%j,|"N6bE╧)+/]gp*8H$r(}XLl{IF7KoU|A"E6qnZaɽ=M ۢ#MX(WI1KkjXk 9$sE׏>*u*/:+eR߄ vy[ADq>iQI~/KU&YlSjU> K4}?ɜ{-.Ed)sI,F- ]ÊYAѴ_n8Ԡ͎vx(oY<kFy֙0fDCeQnC9;%FD~>;R ߥyv5H;az.JCA%K{02||B_C56LP%,X;N %D O-xD-bghIV:,zl"k\}IK,Drf'tg.g XNUfyN͑n &/;G9~\Y≮{bD-yu0ѱnGKnH~CQȟn[vyr>HXDύV6A41p_>1>xr9y!.I`Ba~>j^A^Fg5fK߾R7hwy^:tEYgy5O&Kt2t<`XvXY9&aZf;S6+cf2qwT'/f`#=y- T06U]͆)^AFrs4#xyg ]&ifb"h^%]v̹[◰*=렝.Oro}Wl;DVzx۶L"ʌ"OxgczU  s gS d.ߥ, rbr)vj%Ҧ.`C K]N:` DiRAF ø}:)OsEAhp?z4%Pȩ*O\J mux.Tapx8j$D>jWVJ,(>3\˲.I z>=u^"u7 +t B&B[e3#X"NξqpiS9oGc , 1W8Ƈ5{<"?y ?7@~: F‹#EUQ#sp iߵ.6'XndX}c2ވ%,NZ ?+g9G XYY c+7ᳱ9'ng n@6ߧiЭ#IܵDsBgnmH:Aj'kEVe R@,6hr{ab#gR˜g,{E?b7f9Xj;%u-p4mH6QڈS /tM ,T+apꭗ891Y$}uNd1-"uհ+jӅtk 0/<8Jg]#" )Y-B{@g@fM`3 jg?-?2?)eX^%2wrxMTBQ|ɒzT~L!e5XjL0 t:5V^^g쓣<ğR%i'\GaUrF?؊`nu1};{[β)~@-z#Gg@n%7vrHEl8cO%PU>݂;OAϹP/? &2߀3}`+1c 6CQK Tpʒ#}Y{+nlP6ڏkӟ\Ċ8T}J6\O>*=3'?u8`x ņs`kcؒ_9AD磾l^"Qt*:j婥!K,@Wd&L_I'@UM 3qJ7%"&M"=~ikNQXlQ)$k\Y2QX1GȆ}Rb(le,m@Kݡ3d3zD'|6HwTX QDOh)~8Vfڤ:L`Z A`߇~@,!x*w!l$3)c{؟D7ͬ$ټ7}qrԙ`=(-0&[eJMTtX}phkaWwt{ JiԽiI#] ],j&έ-]2lA*6x2]@\y~ `8_x'LjS U\׆*1VV__?FsҤb9C;4facc Mz ۙ~ߑVJI]'1uiQK_4s2Uzu$YGoVuZmMKNϺE[ppBBk`h3"R2\^J5i jqC֦ xԭI8;7 X+h0I= . : B6vf/82q|s'xW&q|&YKߘ/ CK̇w?w (r夌t HVlnTKOmGy^e}X6D>'dd:z_O ,1ptbi`V5z[`䉞4K$^[!7;5n Fr] 8L!M 5!EW. ti$Bjh7ҴUD|̹f U\IKd/d1'S&I""”7X0SXhBP֟ uP#Riy6E|8MI<QL'&mHfO&GZ,1_SnE92P /f~&p;.q{'B-H-8('(p*؂jq git7tNƦ뤹AEhHB0١QETW,%6{%cA{Fʟ#eW`(W.{UoՁ;Q6Ih*_eb.-kuxBx+}.p29e|U?YbE"|O)'1JYEAKF>3pfHƩQ@.=aH}V *u*U; L&H=\zy OnHJnKЛz?S~`wQ-¼9)z:gv9!p 3;H1Z1DA=޹ەbh&ōL_6D*j4I,wRV/xwIg֧܎~oԢ뻥OډhZ\TyvŔqE[ *!\$ XCr Tq޷s1}庭ޛv8`U!1FNyI̳t-ROzEA줣ĭ͉΁2"h؀Z .*;q=Z^nse) ^!ABtS4'O1?&m+|RZ"M$^^}=d/e55YcGYOw yR뾿_ 2,8e TQ3E?TÔ>¦M@P؟Z`*^~v?eG"CKwQ!d9P^!Pm& Bf$$1Si0BzMk.;dv%?ދyLx{[1C*ZxqK$R[@ƚMlsPCZ*p^oi(Ď rˏcE#y"bިa(>㒀 v~ɄsʎMO`ԉ[R>Gi/NSUnNKL\gX=foj>wdA3ZQZR?=p$;(5W:9Bܕ1- 0X A^"N )z"Qi_>qKL<IS?4Syw+ P70Ivas5J$sau^OݚN_fi5Gos~n+m\"Gʴ1t>:Qc9lRvzvZ/o#Y1`wZicJ=?NM̜A+)or` J YKDfD)sGҔ_5Ԓ6d*ٮ o͈ʞv'eg:Ckn~%Jtlân?䋊}nY-ID=ؤ)/8>?q KL{TctZ,mEUhY+H(5Ս([>q-䣄k~`{#pA7-XbE6(6uk̗ =Or*2̋-3 %~boviqoFg.kFc(+NI) lFU$y 0R#Sv:RWҽ=e%B la9ŶР^W*Y#qazO!tR}ɘʿU.|̐G}"] qmsAVPS;h"6_3r*2Q-ӓ^| o3wD%JBژ̲8nny(^Z!SN<K8=ƥ(9h&Q?A$g0qJƪi7WZD={ wH>N濞LFX|d'< (3qґKobC`BQ zL{'Wt}/!"7G61MEo#F S*'AdVɪqf6/^J/"Ch/IY:8U0E0+ZRnѠi.z9eq!tty 6IfVf^ n$NVTKC& OFkț| Hj7F| &cdFj2a :J.( SdYږb-y{˨U3(@!UMMjEF8}V%B':#HX;kP2,/l z0NH"#_7YȼҰjVSk,^&p2Ob  CϩܗVչx@⃭}Y3YBUbi>Ipx? w\&g~H:kmڝ](iajbc1 xɹnR<Õ^:|SIx#EWnťJhI%MsE3y$8 -?Ie1"Y7s(އr!(}Hef6F# hib* 3bhUkNe6sc^ m-ԙj_*/K>| kIiiS}{&Tӑ'J ~rÓ<01[֬\4ɳmGui0HO!~cK}~OLk)`cImx:&REnU5B/x^)~Ԙ.i>כGfv˭Zl(BH{2L.ۏ;m$뼔!.{ݾfE\=N30;jc o=j"84t #E.@ԃBOWރy-$wzݦ6?[@w͐tr~X \_RDnPOv1Ɩ w 44-]xGG;(=r;c['ju: ?*4Y퓉޺JJ*1) ]@w}Bٍ 3z5KDBV\U!S7ոv:`b2Һg;;$eh(M ? QO+U[\^O6X G؃78ͻTBЙ~7@7{u7K1"ޥh׿gl3]IX̴F<{:IHGYkx4[lD*gt|˯5Æp_4I*eId kJ Rn]M̵b%DYj5Oc0[ GC+iC!n‡Yعl0Zyq6PkLSx^7Ƽ@a۷3jYƕ?X2laΘ(Ž)2R޾(ҵam+Jvga2VMXl2KR G)`i0+K0 a,Z97JYX.ЮEp$,?wƠ=%п}``Hd'K4 jjنfp>"O 5JA|P}ltvv wiSυ!Yo#BJ aG8cw$EQ§,A5 vw{^{*vuqbHGʯ,ݭV/xF 䗚WMAh BVᮬȹő GH>?0N0 㫤4pLhcVw$B۝oW f@QlKtf~zb LХG |DM V}ľZ|YW$cM\pm0,#+|9d+qC4fD46r/a$p1?-( KlRHiR3֟ncPEna~Py(TzR/wM[iUZq*lU$\IlK!gHn\;Ҹ嵖f>梓Vsi? 7l?, \΢x$xEtϔ?C8'cdLT1-tsȥh^/g'.wS"e4x03 8md*iPxW.Kt~@ "vIwy[RТB|8*g<+3tj(de||ܲIk@=\"]PKN56<΄kjs.#N}4_ _լV'~G Veۏ_ƤIJd:U^x{<4̯1gr-.4qH8j#]!xWız}U9'HհΓ1VRHDvf|PPgg=1vemv؋;H`\nkuoA%{<>4Gz-F(|0b~y`{B0 J=BsR9|2`UrV bn:cOtp{ѲEF[ 6.*ĴTƏHn\AD܃b4F"pU)s'EhSut^ V؟d2_DWAkiyǮHt\1uF:gɅ TFs Gى,g˜ F hue->72W~.흊l}<*ժ0;\ Yı 5pƹ)-W=[t -..~OR) L,ŵ Dw$ݿ]Rq0"+ ׮JӪ̊^[]%Se`F\ސ)pW"7+&pb`YEqd[>Jc+7`pc?jȻz_Shw($w7'$!d|qJCEOrV4yġKLb T _WyCsq=.`]t|験0Le&NV[' 㿑;{](>ErT}.G:bV%ƁNbE[k1JwAw?{:eVUzh4O~}FH#0_,9nx!2"[XbRD.~˰|g[!A Q⤹a2aK.Ŏl%3AZ4ٺ*߹'-"/u)OT$`]03R3S_s7k %}hlUP d^7v9C}`-i3[~v2l.Qzݡlp(in?KH :s:R,^|)MAȲ{W"x: z5{n7?q!PgRAWptU0Ev4Q M"7:ѹ&;'qFGSu-?f́,D(IlyZ'~Kyퟷ^) +vzRqKoE$Jǭ::Ry+,q)'IR7ӫr3Xz+2 2DHbF(#H`INo"N&/(s 6܆f2`, q(b;ù~ &4j#;k IuI,^׌]%S )̩fv0v`On0 hyf΅D>Y 4_4+ZO~GqK{disA[[ KЋN3RLCВ~94Ȇ'Z02ѓyϳ+ap+cH姞?rNxl?'JhP.^kv}хp?,$3?DQQR;unZ.M[ZJvoj?˳Ddq0u%>fl'ڳ;@ֳ)FNۉ_E̻LP |%xed J0jfNj1_~nnr)⠒X[->7P*Q,'3%°׭ۉo< BE>Q"B ѯAx6X4b ii]7 >sش!Z98ųCK#CN%GmL xa}/тCǤҰ^{qAio6K2}V\́RXh!/9h?8įއOn`=yyQ~U2ܤxNG'؄ٽgzX -U#{U =<KJWg+f[u&GNӺPN7*?SJyZ2 f?xE!A .u#ovrGUx/lsJj@9)h~0%(, /;,}SY]nϦ@1Ē>a}}}8RCsS )B$ 9Te"ә;ߥ~Z::sC$'W ^Ɏ* ӯvCugfא-5aB6qyK^d笺:ޘ{C޺1`/^u݀ƼWJ ZeGZ z25sXU _ }=S8B2rCw&ƣ˻#TSF71[5`HLC$5ƥ}\hQ?E]5KaQ {֩wÂ0q?+(p*r^F Q 5$(Xb1_sR9_O0UQi.iؾۤ˲$nGZ t_={/U޲ &ՑiɀW`u.惬b&cbIqSRQ'Um3y~1؋ygSm e>TeF_ߴ&1K< Fm[\Z PZ/NyF9MӬ<b9Fd5Z7&f& r jLnY[x+ Pcۓԑp,sp^Q1őg"f:tpCM*Ilwm$]юhgG<@Qm+ӑ3pm1ĸNr\:~ 6bml`zR!B*- j4Bf̏_3tJ~Y΀"->R:|xšh Q46j ,fq;5YڄSRrU\X|ptEwȔ~X})x,\̟> Mi^/0oUQ }" }IЧNN &(|\ؚAuvΰ CZ<ZB<~i]+BSE;:6 C$o!B6`nNKE|,]tu΢! . ^C}R#xUČEoSRY+aɼ\B/b;3=Ǹ5 s3m&c*C[Zxq-Nީ>>+ ^#Gs   ugseIS0(NZzY?[glYXr^u#O@}BDn!d0A(=0;H `+3v6baWЬwO@ ag5΁ *z;Lm8SOu~NT DV8ߕZFi*,c,vR1Lz'E%'rV<}F8DW[w8'nf[bɱ׊v8urj~4Q8'EX}-[Rx9q3onXMh +A|mgX?/BShFKTTr \AR(J >Etckx}L]|ՙ  ̘cS|虽ax.gd0KG?[k7yc-+LuB0KR,B,+%@-|;9V}%.%Dz`*;iw>"11bwʆjzosl7_U(003|h˸M8WY VQ,j)cN_TdoL\-z)۬ lq`kf`UJ#kc5Ԛ8}b} *|TH=AHY9f }?w!G}"𬹬DB+5vmg=LܤS{O ) DCՈ5GƥYRsgC<&Jn)Ee/Q\n"GuES8BȈ"O=ވ&st/qڡ-SrqԽ߱l0U{bM/8K.Tw?9_MzӊCI+bmv̯}7Yb[\MTH~l,>6ށٔUwtG:;>JSԭ@U4" }mr;/bU2ĕY |,Rp3>S]# s{7Wµؿ czc8٢|)[sBvi&M5cȴ [Ξ kLܣ!Pl{+ L(6 E$}:"?׍]}4%)#p<3jʣ*Pϔ#TqoMЕnmbw ߔ. `Zʆ0!R꒨hyGAPN!\CH)H 7G&N)L%@J)x |B>Dk߱ [tSǵN`UjCn 0d~-j0fHYNݬkV#ՒsKr,7n&8@:PS8# X8vf"f0*̠Pߨy-tvD[zd˷eH_rlY./A##!TVIW|m~a5\2 m :GkCq̰{IZfo7W/\T}Bsj CX ~jP5>(kr7veRqU>HL|DCgzU}Zn-ƼPP*`Xf(Pv\̈ʯf|W5PI 91rW ;yK\N^1׺1ueWCn1n$j.&?MBǟM+~̢N {.:-Rr7V7ƄO-Y"k;w:'c&o&+ ]cG?D'~m+\, xHFm$Mٖ/;81SO$ ַtU V$WGQ%V,osI' *%( =ëN#d\) K?{rytvNKw{/[(OF XtRKvPA7J4VƟSÜwA9n zt"iM*h:iXL`C):"4'sT@ _(iǫ^l/BlDO. :>0?w3!ڬ滎T":n.rg Ԅ S;ֻŕ,~ڽ7!s1$X>a~)M\ ^ظTup J㢴[%^ϙksRuJlvO<"'#緥i|A<#T )}rf])Aa+ 5_E}W~V~z]D4k\[` rn"0S []iZm)zO"cXf;H".,Qr=2`3} BGbF4sM:/Kۉ"~(ډi N.s`(wߠ 5Q~׿gX"Y-."jIA9#M[B #5Y 7xw, \*^T JppQ[1,,ӭFs܉Pև90KT2cYl T0Y 0G{Zw ۿa~7?d!Y:Ͱ7HJ˲)h.(9xMxJm@%̹U SfH|S+EE:B+"}=?vM%dD5D~-`,W8Ӫx30+Y{t'dP'r%bXgTs jt[P.c7ɦZptrY}\DXwy悏Gs;:VcV3;8NےQoV,h,xA&7!tSJD?UڿV@f]X>Y`^B T#G f4WQDټfKH߈m!mYI<!]]mOn/8aѕ[Mi=5%zi 581qaqj} ^pK҂H rUʮ37.C%' .։Qoa,"MP AX5*Og BUaǗ@l}hVzm@J ,_^ns(lL>aQN;SWۂx^I\'2 b:/bDFCǙ/%[!L'e-%֌@ ]m.v+>ӣ6 )0c~cYH#HĄN|Cayȳ7>B&xpX̾&,fJpfDь6x+8M8 zNVImIFTmjiDS|=#qrg @Xd&Q"7}OEO9\q(]ٷl3`ؙDFuK9U*KP͒dϫx6NESZ\K/4LHQ,zb82h+~(IԸhDOѩ:1ɸâqs^7UwI7<$J׀"q޺룉X~}}d; "s9SZ;/MߥKmX:PB?m,{-'l#ԃň$g5CLyƫ1AjJXWKDAtϺ M.ĨqQhR=#ӲAi IsWS|#U.+oSk)/UP9U0nw'En\O8AHKVvqL+,gpu;Z{ma(Oe hx!a) ߍ^>4yP dk@?</b!3Ų^yJeAXFqxfFYzhSSF~Xc眢=+'Hւc ]uer\01CmcϡW,6]0=K/(,xf;]-P7avOE wj!<Ӈ/bPx{rT#͟|xQL,|u+]";f<#.| boOԭGhyf͍"ͲCB@V;=/:<!~<6;ZzF?ظ7@/-?[=ggf!aPz.+{O_XˆSPo'Б!##,vEqUmuؙCReo.aY!JGyb(' {\9A]I1'=N-osx"`[t4;N$.#N,e-$CbB7.s|V&o2Wg[0,?(C-a/ OuW&3vhө#+S :]k6G$!e{\>lf˷ %=X&5d2C.X~U‹VU'[ Lz$$ÑP[F&áhcȪ0YZ>$y hdΉ.xu/>]\-< >`BJMW"6<5W͒h`Y2fY8Ï0 ,)F^zJAAw">p  xӆ9SfpV, ֽ%Ri++@{>2m 0 Ji꟣վlq]5NMj%]ɺmTjO2e_q)mƅ{6ސEg>P/|-t}UN6Z9."4-f |# >'^R ev-s:kΥfء[8YhC/>߮t,G蜾OE4oጢNJ5c .uIlUIHEQ? ޭӥ9['õN–Pv 9?Vf)j:~#5kݤJSJqgJPLF0\BA ",A_*&p<u%QXCMV908&vOSDY73 8Quu o1yq T%.C~fEE0EX^P ˜ZaNjZfa]-b[$"i#Kl.[XbYxEqR&3L%٤#~:#bWcYb [I CMvgɿ!pVI׀{SA}W i3y>G'4CJ2$2]cDB*8?߻EvJu#A4*ߑ= :9 7GrB֞rA)-|x߃N8$c54oC%IF]DuwF;N?] )HS~%- *&>ieǁaG@f`P.[N)hmЧFf)yyt^(6%#\G"K̀TkRN:tk'-!&&pi: )P\H@I*c[~z8f!tI@Z{ 7BX`+a>4B<14z#23PP ݍ^qWLm#vGTk4([ O$/lYkoh,(=vc1Æ}j5>]n cqg7ȋ=lW:"`asck \#H<, GtA2дF7[tH}߬v\iq޷K8vHAH;&avq?P^PSIa,үau(j$.+n}<8 ᲅt" Nk]%Je,+n/xj< ņֳn^K=ʱ<ۏDVq8& 0@sׇrGE%Y;NugJJ#'r3s I{6فϲ%Yhn3Cbd)kP*S9N:د-Y^ vITS 3.rwؤƗjlrCB<1F1( RbtޘWl}칃nB7Cœb<47Om(b%30Uh*L,6d>wX8r^ 40Z4\Êx! FZ^ĠxTb,Uڜrv+ҍ(89 / C5< {36 t4_MziDTH1EGz=BCH2 |?:d@~!٤ka[]Ou d!F-z&Ksd.OZuſTD,i#Y: }Ymk]Ŵ m%~Zy.9H91aR AGwW~j&R?(ԵFq)ب bУX{@#Y)yE*N_2ߤIHv-$V.uLl喉ե=CBؤjhJU_@[P] <,A%UœV" (WqK:ѶZ@Xg70m^A_`ࡈTʺ{IXܑhq-;`! 5oo5>1t/S.)5ƦMM"efT3OڱժzMx%)K?Et- sbe9i6%/,XlL r_Lϧq_a3<&@}iOU[!;Pb68D}Nhi^umsA}6?t6Y5!ěM/HᬐKK&5kNfNĈzRpL$_D3.s~ ,.'-o\-IUBkK;ELؙ}'ʮN?OӪ/ۄ ;Џ*-0e +5`_ce, ~|c54R~|<!)x96}aA/2rKZNoxii$4pNs3Rl۫}:C1KFӂ-_}Ñh /ta/}E[\l䕔VʳԼ@U* t$ZaMm!\t' k&Jyr*>.X 4aЬ@YxHYv野eT"<'c0NT=\s#OBO 3LƠlstu˭fIĐ4)yrfTra T/eڡfdqVBFwƒG,[B5oUrc#m M{?¹|w:qqS{޷4BpVsaXEL 6xvY2.:MSE uMüwJe F2 @Λ,4lSҽojZI&gD!㇗1Fv5F/Ęf}Ѯ.`%-? ç"#\S 7lvJD/_WYΓ;2a/?Jʵ+q`-4Ej{T&y .,gNHT``uŰ\ע9!dwRG/{f L=լap#؀wzJ\L1U`dL?h| a=]iE%npոfyiTsg*f쎰{PS5KGEIxykY}v&IjiM*^AaLS z ^{cjgy!ӔKƩ4*99s]WՌZd=?&lJaYH5&7c ) W{Y|)m޶$oNm$1V٭ `؁yl('JMBTO>+ίb;Z^ D{N 6? yH fmjM'' X-,qq1i30OKY$C n#TW.DC-%3^h//r}_O 9>/\ [0No!} Qp/ 5:_}-sU-3#(O>^n]RGJy'ᄃ4'?NDWb.{Vʥǫ+νٍ?L]Gm Ybg2ń {r7vSp1߆bދr}lc{{Ȕaw՗ut뉼X4އ/ɟԥw3V)(۶LvWu?6ҤP0v%VIqp4II(dcK4śYxٶiH IA*?/h* 0?*mP*w2)u}Uh #99N݀* 1_;mc@$N6]_y~_Gl]@0C$xK[P>MNS$^Jgozw`hĭ{rڴʎm] Y 26!%]`|"4[#2xY-\&CܤI m)tk|NKZM4s tFB*5y`nРҮh "TFA bVAJEø^0aL0vk?~LFƭ~e.oQč;6CsЛ9 0!}P7\ḋD{>]b]a6?!febj)heeҵnN$`&F'c ')T%X6$?FS0?8Qc߃>f`$>(ڎcKUi @P.(}o5RR+L/,2$sGٛ5Ry׶|NmW-z4 5˲P&T!\+'3B ~/%FvjQz5:̪Y4%mas zKXފ"Qe86v&IW6tɏzmM3SԆ`8~vh}ѿr+:Jݻ_Vqt@яys2$x(-*WK/# /0ޑcy87fS[Ҫ5xnN5ӒN _1ǩM [yPg=5`whT Y,upGH%+t#&ޓM&yW> cQvclNqE& ci.ڸu;&̐1oW̲*RcB;r*zw;Ch΄ϣFxBf*Pҥ@2O[.r:B*k?:Snx䮆w{_EfM$g`9(*PΨ6SR$dbC2\sK,3)N!&zh>Uu哋$eHOBu%MBB*鼮f |ϒmK{UUMff-N!nydgB6٧1 yNUq۶Z{,wz7Rt0ݪҲ|gr,"R|7(Wydym.VVWLxY'<%+eg E_3"m'ĩ~2pv "Z&F3]"boW%.m70l%fm%c3Ncn,艕a 5q[_"Qf{4ix)YKE6wvpdx>ao'=1>b=lJJhA?AvJƪ:7n d>/^2i18Yj롾S^[˯Zs)0荛cz\N 1=5 RY5v7ZoiJgt3< ԫv%U*[&U,*V/ gi^teK걧UMz/FҜh_A78ļ DTE0/r\zDcR-BDf [O[F:6X~rQ/5/ c@k--YESuiG*ߊMZOqOCuS~J\~%K߳n/0C:ޠ i=8^q,mRw ';t~(]ϚY{]ɑ[5?4Dz4EI|㡿$zwOAH1צּ~򈛑,}`\cMP {"̘ ]u k!k3N_{!=Nӭy%y+x϶dwc1R b\ӝ|JͰ+gYڐYUq]T2XOMBJ$TKԙڕ;Q!HݞB>ppwǺy`VIno#peU?O_3XA][H,3GXAA\G|cYߒJn&ݤj$]5pu'ؠ}4JwYM{aSt1#V Q=VT׵4\H'/%~>m4J_2SZ/]3LV!0cjiq" T;0P!L^Lbmca%_XZ H@\`ZLx:/lrNu6b9=.kgd6_0S Ut uhS8r|r@7y&-m yl:Х%BVtˢŒ߈֕D2-V:Dj㋔(Sd&e"E~1(ZBRb]g{Q&|l<Q/nWbz w'fyθKǢ5"ױ¼{7aC 4FeTQG)jpl\}h^CXJvIԮuqI}yJ.0ZᜂPg|6+UȆ ?XhfV;9@m3!-2ߵIyܞd[z rU2R gQS;;ڙ`Ȧ ^w1:y?IzUqdDH!s6Bq G I0ncrl%ce,HkCY4h lؚ^EcXօ! AȘ~A9y";qGV0v/oOO]O@3ᝤp oW,>I")yTh]78.x6SYʿM5ִ)Fe ݚND}ތcZ0X"ZmPS6|vq[ѢI1޵EFU!9B.Z]?CmpXd95}e)~cE.1Ɋbbz:qU)Ԕ*Tsn3xo̽6mثXE¹JY&O}<@.uϓPx tݑ 7Wԥ.y밤+\g2¼Q!r}vh9x 2̪^. S[z?YjLIi8˲xA 1dC8qz w0R TƏޮE'vIfxDb=ZtI}+t#%A"#؏K!X=( +/[r kKtjg `)9,iZ*1ѱ$:JނϠ#r?a+p D:mZ|OOPYwIEpAWm(Cf@)R`vџ`:#Y2&l;wYġ&)) 0%ԝ{,gkrL wZ$N;V\G$Y4xkmbw9#ߘ^ЌA;P^=Ziېb4Xؖ; :Ex*O1JME5"RVBa?ђ5t`QŴE/l۶v|b_ó} };?4C4 wI nEm/4W[a3 P=)!lB~X߭ mWh(d @Y04n3 38! L$/-ѷQC;0f~RHu!=}v̔G8IU>kg)q76!aݶn>6o"t # n#hhD!xLb)/M0(Vmr23Vބ Usi< KlI113P,8sjwu{^lT.=B*s\6lՆW5s.DZWhWV0iYQ;,S{J S ] E5b.z1g?aV"Yq–~34{Kmg9ueqc J&jE>b{ȪF" Y.H;ȟAzM&m"z˖e"+Y {@M-=B)-)WD& ~ )^ndtNoʇC،Oى@CYR9C涁[ڥ/J|U'\\uJAٲ>ExYWy)< O`C}ot]zBWCg[sRDT`!v43wde~i=/h_.%>W>G$:D1%G1ԧ so#-hxJ!|jW}?„ɕ+H!m'2  DŽڻϻ3 0=,%\OO{j7 6$e̼f:_Ca`tնym w W[>y)6IP$!1P~&0Y3QB5-$r> 5CnK?tԹr@yt}=Jhv<Ȣ.!k-->>×Jf濓cL Ay1Ϥj=߯5{bߝXWݼӱ0.ln3Mcj2@GoƢ˷5fs\LǪH;/c:VxP%z0J}DTk :Î-bщ LAD d;FC_IGK{]w=Hcά4eD("Mރ0!ĵ;&lu u嘗]6yp" ~\aO:RԅivK7h-JG}BM2i R/ymEl\eu2,ϥF;p6"mF@e d. z|Ie]S!.VOQwBɐu̓d-`[Qγ(LwuIR%fG։DY˼t ,chu^Jj __9 I4 q,/;k%9';M.oJm%ZxXqIpZC,_]7ݭ+xSrLn^P9B%o^@Y39a$o2hPo'd=Y$ukAƸ#y}K%TP]>s$w"墼j stjygvw2Lg'ё/./^X  :`8p rS+{|AL8) #btg@0 DJ,Mٞ Yki~d 2 @I6%|N#,i'6m˵,kS]h,. >fɱC ? vu)@t6&n{/8|Q0gXQy4P2&ӶzKXUջ[,)G$sKG$j'`t^=-T3T6 +F{Q.Nzrj 4JMoa]gbKk6X4` GXZA֝^0\םPmha&YR-:{) :pM>TE#[.qxٿUivKIH 42G<{K 2$4[TLk5H:Ŕj~oBCxMtv''icRWI   r/{tq I("Њ1S~*O%xcL: $^T<^x8ZSbD8v cf@}$K^\vn("bBYC94-:J R8LÕF0u8ЪYF&454t~4ME JJ#50xG# f.O_DžN>"ή)o !ڼ!SNhIGHk3vP8|ٖơ,7IRQK,驿G޸r^ 2k[]O;RYRPb%;MsJN93,zo-k`sjP`t7Ї-s9IZ\D}ϵ/Q?ȝ#ތ" 7lE~kyۜ5d׌ɭ%Bƥ a(Eh/bibU?B6To6-_-}I|a޾So$uqsS+b?CI(\{M5)=xg*UeɼvA:hB1ceS,pަ跍i{eO$. !Fycqy*4r[i/hzf;Ȁx pt׻$8[(#O$J4WdbTo]* |:=IA\Ր>zS8?\9xr$N Owpc@ P·$Bw 3{E1+兡`?{T\MT#>n`aita`n2 {"o2*69ngX^Ď?6FdE1LBM,)%~ M%7Dy}cPgd `| +ߕ#E_m fyu'+lu\7!3;Ԯ'1cXK)ORNl~+uLdDZbLʽﭔ#-֗ ~ EӖ6!MY'IlJ ;-dnX HEqɂZ=r 'mG{DKC /rcЦ&L(HbC;`}} $6. [j%\o.o]O r| 739[= [כǒ-7ӑbfI>UG%u<̵ȼl>Iny_Gc H[XL)iɉ7e/ zE3@Uo"\.=ܘR1S*t{OoI{g)RI 24_< ښBއz"ϛ{kF',ZzB]<i>` -dT /[:ESEeLҟ,މSI'e5 ]"V66F~p3䦹1ˢI]S+*G%SSBbHb>r4 hliHL`@C~TIA1N y2 uB ׺4|ipj~9C}@D]5hԊ#Qe&kyV40dm}n- CQ6 }hBjN^ ɻbt>(V?l">[Ɲ8AO7D *-Gx"]}Хȅtqee̘^BipB Рo_ 7uej%!(A eynQۑuFW+534WG:ƢΕ5^{Ye>ʀl Bu:$v*dKK6:b)7 (n8/lN!ߴ}fnaw xP趿8F꓋aFe+_ίUY/e1$zwu0݌اM!/ȿ 6_*jOg%cgkdW:ĬcǫJx`l @ڧ>"a|a|Ѽd #<$~+x >la1əܸ5hD" YNFg"ig{Luuȭe*a(8&'0:ha2jeIm$zXu/*?|tCc|sFS[‡7RZWM;8k.b:𑺼!]PRblg;z?n5pY󱍟ya)e6/ǽ>k15J 5݉2EN?rK#yHEfQFdLsRnҘdû9wh'I D rgC(mb b80AżiF;Ȩ gԠ1?\aӣ7ȭƹb~BUsCPh֥h>飿#~gam[2E8JkKTڋ(R$d-w'h V'sXo9KSGs{:;Q8AF^IiasNg+tMLm{wЂX3()ҶBE`Kk3-ԵĀ5G-ή) K!!sqH g Y<L6{#[7sA_U19eh] ψgB]-_5M6;lKG`1^!1<$5dA.t#yljJ"o0Aֳ 4W7Jz去>zuw4|34?)Km% (Lht&H*AX}HdSkw<|& ;pN}arG$F~j#q,4o>9fg"̯/s &=w$u4,o(h\nKݛwz+Ь>Z!Mӧ@ 'تgpyp|J2DN*ЯSrs:NJh) i :KW E4EPԶn7" >wikF:pʍpIg>ŜbǀB\7Nx40gϨԤTj][t]?ęocvv $Ah˲cwv429IN'-~ @hZB"'딖d3cVw~sd>;ؘF!Z'Y-oem*I'AXRɠ:C03p :rCi9Taq5 {[t%i 6"ߤƟ$ef|<ޗ(N+\(}k9Fzn#@? cX!B22uAa EjYMbI_V,%a[ :<UXtK [N 3xCtpv]v; Mq^6(sa=7}j.nXO݄dQoZI8rT**Zw[?(Qr xcfާH ?BHf٭>M|fA*OiFWNڠCS]bPlOID+?h1_00gQTovL(Gt{wy^n~/h$ p)d汾S+mo5!F~.I%i‡J:3 l)"A4#V,7D́`['ϏQt$)3/Z}P>L']ڷ)ը!pn'bYCC!׸2|NLcSq/XISՑLG/H[My!OtqJ.Z]eif9u@} tquUш+n,:q 6$믝%@9 %p9`h1 ݭרI+@/v!P+gȀ)('AUkc5UZH@_3'*&"Wyt+d! NrG_d3?a;B@wUSѦDQ<.˕lt^ 5] ^sոQ__kdPe<_aABISzoJgqƿE'oeDiS"|x"t ?5fm,LvzqYbXbMw gO0A#УVbi0Vs1pMtKkPΎsVγvE #zY!^!-Wk>Ԍfg!ۓ\iCSf ^$a~}{7۠*Grj bb}[ՌvEK?TTE`iA!N` y1Vͧ²6abupykQsX1(f < #>1g ր%gn޺z@̛wa{֖J7A(bsIԫ6ڷBۢB'/>@υismxZ$cgpqYpjD)XkS!Vj(f$SC5 ;bJ9@-C$oJ 3ўfyG,dUYZDn~CXvEZJ(sN Ȧw,)Z#Y"C \% Uʳ= Eż/ .0*\H]teP|e;2îQ'-+hKkL&xԪCX¾{ܞsbvR\w|Pq ڔ7LP$` Cκ*-UĿzˮ`.0,;E@ͽdؔ78*nNqnfMCjNx=W#NBTeKvX:p!xA&Peb%}T/Ĺ{sqF؀QCh;/H'r?tZ>B`֔UX^? On0™[C_$`Q*ݪ V[ְŸpd9mZq1X`U'V7`[{~I8Jye41?%n`Ewu:iGT2[mgnR.2?Ak4Zn;JRG "2^tv^0R#[uohJ!b~0&`Hw2n c>NW8qO5 uE&ݷ3BoZѝ]g`_MN$=it7C_~ܼ!R|?6GaɘV'J }D!2ʨ2}~_>W5 C"ލT9uUc}FvSzI.SgP޿bLeD eq_ %}F{=8w=Vb4~C7ҙ4낢X79DEp̿m|]pܔ]!*^OXepEw,x/Xߏ| 2շ?flzULf?lJ]pr1<b<$UO ΂sar?>%M)XlK>LVNl$5CB9NROi 9ly .=df-|`/0~5DP%C_ /'s4{Ew[ٛgP̋.8&Հ!MEIC"q+zE^g){܊䗑.#;֕2n.W{ȋ lKjI}'k?'J\"3J`b}c'RE ]n2(y0[ pISGn a!53ytp ׬ovFD];:"o>ɘ4z> >Mcp.>UZS<g u㾎}K4n;2[RBj#pX}3==IF`Fb1c^'k O?.dvg/q R:4%:C@o9nF闂U*{Bw9͢3H\s+Sʗ5@M$Ґr;my~ާ۸ݳH>}+dhၰ< /Z!6k&MԭvY=6S@ ,,zI/ϣ{IAy+~ScwK+P@4+}#GξmiwIRmU#ɵ+ n]b`z{B5J]qu 5˨-d;oUI\eDwFy'a>Lߋs<$cvd}bJPzaA^"ie9$q"R@m4A%#C0%JfaX9S)8$i"EWC_|UsգyN t y)Zʟj0 ZYbu؞{kix?^[Q%{@4$N/$a#4'|q7ܮZo>'J4P&{?/U:RANQ[HН!Ty\#7HX`-$ wfY9HO%Z Z-U8YIW,iOҮ;cFB7_􁧍數'烯_&ɜ槵#ᓀ*4BJw)UO7 퀌3ҏ/a}hf S "9甿{N̩ "2,L'#JqMPN﬷H_CSᇡhm^Y/f|q;w 8}/%EVvQqf  kJRp*g9hX+0oOXj&Wi8~^wPB՗m 21e]a.E \Zmbυ55&ql-)?rθ$㶡J;IZ5;Nl-NĮ՜<= .iO]b&BVKPsT"w?jz( q<>}4O~lHi)ҌiVt`'>D`_O\;%U2hq DEdPA(X·?nVgjjL3Eދ> NG$vs`0>̷MQW">ܝC#fDpdEY^3[|>b ihc1>`i aA#kBtCyyL(3\؉&^2UڢK]7un[]N,"NdG?$\{~U-H/-He. *G trDvBјɛG>Qh(a*Jcە- 8S^I `{iK:3=<) mR񼧢E k2G&f1:xM]/Sߵ\=yy~ya}o7Iә^${WeL 8:ƥ3bEɮex!Oc2ӱ8r#R_5ja=T Z<^[/4dek>O&9tl X].fw۾XrW]Ǜ \=[^ġ((TU!"Z5勺Cĉ: :5 eg㾷ݶ0eaʌw̬ʸWKbQ.o:p(^"m=p[Z[י)ڦ)gzv{I B /v2BXB=~OLJW+h·Ŷˮ&cߊ\-)T}V²նvCJ?=P idS~_W焲F/!T2 G̬Ŝy't\ovyXI`N%uSєwJHXB?Z]pq#xMkfQ@oW2gO>p1|m}@7;`@M{H E Y{YC ^A`Txy%8/3䮂%t?) ng7 ^BgoIN'wC5:Vdi>Yb<e:C݋3#"X_eFn EQLy|Ŗ|^\5J3^'\Y$^  Chf[MP6cq7~.\.,xWھqL4oM'H<< '5퉜q^`;[4 dp2o3՝8meVI>F-u?D#x}79y`!pV3bd@xhV`@k\eSɄ2T $n*Htrlz> Olz *NrFִ ~B'zyxN^?#`$73ϖᡣ3Zݸ_Eu|"B.fZqk ⑂GBXTΨ qSi , #rx~x܃|J˥BUKf32ۆ`وkXėA( }4?o&GE\AЯ]$xޟdv,T7|7x= a%ϟScݽNdd'Qp[TkVSnE ps.9JKX0S|v4,"AUuN]u)F5v% JmDD-JDe~d}(ėPdw_Cx0ᰚ漐lWۜۺ\ы)j8tjuB+ͩcz=yAس2>?mMқ)rjU3 U9QiK33dl9"ž,s( '^vYHFVB-#m _ PɺH)wQQ`žw(jI*:F!uhۉjjפm8=6apP\{2Y ZMHHu XۛAH$m%qMxC0b"K A*U#j#$٦>kD myVosQ5wӤ'bh a-poW+rt`"q"=M^Z2$nHk}>%2OU=D$_Ď9[hhRAKr(>V$B+lٗTBS%Oan/~Q_^x  m$C>cOk"h eQ{D}Dons9SWsTu9/ƌc N~2X{%Hi%p ]+!gOiLwl>/y* 9 »qZi noW)v=^D׎Ɵ(྾3݁_oq<$2pC@Jyh/>$'3O^ ULQ^o`8Gu+Ll$+>d7͚[);ˀm% ʥRV \QXP0Q3dbh|^df0& ˠQZ_{e  ?XmS w7.a6ҩt3u`(Mۼ^7Ѽq/mU~a}j饶급/ߧөF`i34>@KGiRĒ?C% w|eU8^GAPЬ]dt3oT @4Y5-1aj r Ƶh *vJxx(MUb^&ݵZWB}L#7xd; 7! A2ğ tyvmFm7m\kwȮ]?~K MV)17ȥ/Ή3;n  KѰ/qJrZSf`!/Ӕq} RvNgϧDX0/7 nmFkT=ޛ,Qwao3OD]QdJqÍUR_ܠe> >u I_);h}2e+|^S+@Ӊo|Dj+E Q+/ǮAw6Efpp^{G4#7dM"#ٮz(9 ^#.9O&^ ,-7G!mV|`84(}3XZV]op z"Z +R# o3xq\N#j~$Q=?A&@{\/=-fbjo٢aݡU؈,_~/aGp[Zna+p~gp&N?eA31bI12 {YďzÈ^MuM(V/CW<- t!סg_vJz*1ɰFVuZŵL='^a4m6>^#f 4WP(Yi( AU`n H([ YZ