gvim-9.0.1040-150000.5.31.1<>, lc3Ap9|q/nd&X:?)8̚ FwYfDJqS V:(>rA/,),㤬;#PQeNE C\^O4^Uq8!2V$Zc rL{SQf_I^?&4,HbTbb",+-b[Amht ݴ+|AQ)l.C{WrOLwsi"pBiBSʂ'P-W"שcJKOr=R_F>Hp?`d  +8<LPi U$ \       <  ( P((`di(m8t9:>}@BFGH0IXY Z[\]P^- bc*defluv0 whxyH.z\Cgvim9.0.1040150000.5.31.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.c3Aibs-power9-13ZSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttp://www.vim.org/linuxppc64le/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiXΈr C&F,A큤c3Ac3Ac1c1c1c1c1c1c1c1c1c1c1c1c1c1c1c3Ac1c,c1c1c1c1c1c1c1c12bf742f5bb9c953f035f4f35a83e8350f1d705dc7593ae3e4851ad6c536a9664761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad970f2d6483d137ebc955e26b69792aabe094867ae21582f99c008a146068fe50508795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0bd203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa097f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f22b498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.1040-150000.5.31.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(ppc-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.1040-150000.5.31.13.0.4-14.6.0-14.0-15.2-19.0.1040-150000.5.31.1gvim8.24.14.1cR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedibs-power9-13 1671443265 9.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:27247/SUSE_SLE-15_Update/1d8bbe09b502e3e6b9711a0f720dd0b3-vim.SUSE_SLE-15_Updatedrpmxz5ppc64le-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.ppc64le/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.ppc64le/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d4503a54a58417504ef377c72aebbd29d3ba8a4b, for GNU/Linux 3.10.0, strippeddirectoryPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics imageRRRR R RR RRRRR RRRRRRRRRRRRRR RRR PPP P PP PPPPPPPPPP P RdWO8rۭG7utf-819a3f349d6e7bf2128376a4200afc682d3c6523a8e3c6cf451aa5a8699b436af?7zXZ !t/.]"k%{J #(\p2g@V.ލbWX9hytd?\X`Rɩ_t)`s91f//Gj/DqH+4˒ɹ|ds( wC6{7 ڗ䲆8i^&|%B:|:DmI|6Cw;ů7LjhX&}GGMG1(Qd;hmHZ:5s􁆘Rg'7Gr.i\]҂{$g𧂉  3 J{%pP/ n]JRqKV\e8\|穵B8X)q j _-4Arg~×9p! p'0XY6~oE&ץ&S6;CƏf39rXqbaOIQ~-y*h!:28]Z~xR?T$T3xX'F:Ci"p#9n*Yoy-lɲ)Q? %B0D((eMF=qwx̆$74hf2=bЕxM#uzb510Vyh8nk jڅ@#5mm,!až-O\Qýno:孄P:R;U9-dUV<=Wj8`SR-x_Ԛ"˼6ؼ Ȟk:q饅9NK߳>ZCT0ߙ!Hv^ J @9qqXU _L@ԾơfuN)ȠQcߨ 򅎏n9جSM5 V\o( `zب)a)@Y];XiJ:C (/Fnd\EoLD$D5+;;Apk1D 4;)UĽkzT62f,B9_}Wg2 hHҍܐ:Nll育jzx F -0 [[tOퟆ < `e= Hq0ޔ d?pό4"NiE/'}ȱ%;EiP/"'0nC4c۱b67uRtЏkHuzoBl e[>}+Xj+2'z((X.X/?jv_;f2rNjiu-֡Q&'X u#f18Y ib䙛Uj="g7 UTio#sݍ'8Ov;Qw f0%uXeCbsܸSIK[TQFd(<(*'aW˥][_,nYh(@ h7<8G[jT1l֔'6Uu8_1olUHK"$}$Ć _$ &BZ^fٲS祃|H,c#MM8 y} @I}6St=Cwsq~l4=HdI03 {t`o^V=rTY,Z\gV= |'!'Y s-Y( { ,В'/[jn üU'ڧ8I')dyd!]5TnzjRҠ oܩB-Z rpYǻuɔTNr23ʛ r|I '#ݠl," [ ㋾jFo&#e`zAbd b$P΍=$ BVj MvmIUYyvwtZ>wԲ8.Bu=b< 5k%Sy\7Ke#U6OVI[ֳ;&4&=LV(f QWpB,YT".iu sy-|,uZ}!pZidtѣ6ߡPY>䚀}w>#*Γ4.MV"Z! )ev1JP܉!7.SԄX tbڪ؝[Ē 9r"'rTPUealȵʆ+oau?]^kDsj>J uE n^Qx,>GYWlUf?s7!ka~ŏ `D 3D/32P> !(:GIsc(6$07$ŰȼzYcr8ei8JQpzQ\-y|p+ FЪ˜)tKeѶ _`hHs r^&`QGk`Q+=>a"9Ji nXcOI cg 7!YS<{{SXRsNs S4y=c;w{MyILm!&tؒ''Iq s+AHנn'8R)Dt/}jY۷1NI1 \1Қ `hUj|t-/ =}DF0{ 4l˩a]o<|ߧT^x=NV8UDՆZj#gƝn[ hn#FpPRȫZ(25|]+4P7E rmX$rS~h]^̳(9%/ÜZ;Km\TR6>68/o$X>y.!-=bML ۰P2De*,o_ƓQjGpؒn! л$YUFWY~Hj{bQep忖"%Q %c[~4f!I ww T[̻ے[5l:( 46^գ못yʞK\a44- )N#(V\Q꣨=. ko#?H><|v*ec}W)pa9<,* =s7O[ ۵yŰ=)ǻM ;_@\ރIo@0inϜ懮L2>.(21`^J57E:&B445s[%] ¬ڨh. ]yA@S1+{ۮB<fP.nzR97:|gs ֵ,"guIY\>9rI_#aU(u"{9:Z%3Z%!h)'Քq4;}miԜ/_rQOnht%T"?]ht:xkDpZy.`ӗk'I~#ZMC( aߴs,J-QϧdNax'$8rM5멕6hUk5]񹎯),CыV듉&ZyO"SzMD&r4dȏGp럻*\[%D*]ryN;[gj7FNObL"J2Cs?S?hW^GNܵhGo422q[WwdK؜+*//3- pN t=[l7kqExH}s8{wjXd>%]͚ZͳK{:R\]'HSBf\F%#ϓX3ϧ xAx(O9jWtPv hAl+~ꑫM؛,yrobGg-4|U4&p1],{D5uKV{8_3z7kNVPKZFr_R`,BU&!d;/`󨎹1$-\3S=c(¯ ݃3`)~3#=-hݓ/w(WI$l۱z(QwH㗺w,ٟSnnu 818@8yL;>T~⮩hpE'[m .6,G+A_s &g]8Sځ)4cY" bFkAd"w!#U\6LeFn"zXzhnVPqM>G_ܒ?F@})\+F8S-ȏ-]'A~PE~۷Ϋ0o(ci[Rf81st_) ,{^,cGpb6B3Z 6;a,^RH4ۑ h 8!,`t .aw (7l7KP@&Sgdb20|:<狼9hCC|4%4jr>iM!C{DL`/!bj75 ] >`bCP_ y%8QiL8 +;(j6b$_+8v %hK76?Yy[ŢdӍVYsh6k9cSFl&H;xbt߸bm/Ʌbu'#hQ XfwUgH pkn9F/k* uQurNVkqرߗ&(,Qqp>ޤaZmvl} ? > >FWe84Nڝوd yyxQDYj:W9G+]óE` R'] T\/R1<009heSv- :Y _o[xY9d66‷s?<7کY! b`\1C6Xތ4UiR]g!id_83e8`׾Pp>}gЇ!Yy!Z!q`+[@N{acqrl*à3|g/u0y^IPIe{6B]gE$.8b.[,L;Ra[*}O;Oៜ x1 > Sc@?c܀N&&ҘVK3ZCV<8Y.m@3=`eƬXZŝW2&H9lAiwלf|t+PGԖ} 5ߚ^`%XkvybGohe~=n1 qMvKT& j/A pd5/%E$-F$!u(X){:YR|5`7&bT#K{r`I𽚙?J$̏G Nk G,0 S' N=e wv+'S,^9l,`s%%䳳?w)A+<z6FMۜaP 1D_D40!2zw;p P͛DŽ76ޫ"Pt]W9 ).CNh\\>BȞѱ\Z(Ʈ/^b`z}Y)D!~2~pwW_fKANɳPg$2 e^g'iσ:>@3iV^ɾ / Mt?K`Oo9385˅1w^@+1CI2dCZ TB}^`򐧃ȁ)\Tc]Z-Z3,O5餐Ξb7..G`䝡G _rW iӛӣ>.u?"LD 3$'[DUEDV">u1`7tcL'ʁ aSBwJ|Aى1i=Կ*?T#c?v.Lc;n2'prly7$pHE%S:U:}J(9iɏ70i#nܼܴ舱Ah VAr+ XݵHp%sxY5zTH`.P7I>Cb2:BE6[ [8PJܛ1PDj*R^͔)`#:(GH)5o>?+*$Z! cEkgtcwGtdQ&d5ZM饇LE|N.AQs!bzMPB?eMۖl*5a'j?Ca$ I^$;z)3٧Eidlb`-OmS%攏!d;p -as%\ro*2x^Pfr+tlYZ#qC6Jݡw()L=NOJE5-pR9dJ%ٕjܱeDfkyF8\Uȳ兩zg1xs绀erS2tbdxDގt[::c#?@ [:R&&l;І Bѿ)XaJȉ 7/4Ç(^2cB5P`tt5#9KK21ato>a;S@^1rd!i[BFq !ѳNkآm M_{5Ӯ' M'^$bevARz$#.ɷ1Z6!vr0+F/nٜ;@/dEbjEk` z*zYaA= :! 4kD>V8Q;_=O$ pW\CU% }Ȏ_b_t0:@6YeV/Z[ƞ j{L#Sj(fDHR)uM[vvmOn+լ[sV?nƬ&TX Gx#fZ™Sk4mLo2 0Z˘.:Q giXd?^g:X۠RBl0{_OS]>`YɦKmA_&oӛgiXlȰA^<^ fHұe8ΤZ'XVJQ3LDj<22ddGyl)? xrryD/:$3|eVTѵA9j(mA#p=Mӟz9n!@1ԅJ52U&֚ GmfzyKgIjXfZv 10&pNx7^Sg -\iT/? %*$rQ &&tQ|T!ٵ8^` I@$,&ʦH_(n |o] (@ckSjg8K]TȼخQםy1b_*0p fI@ i .e1|uKqQCYkSV16})I8Ԛ!xK9hEh1^|gP5ɼl մieo 8J?i51Z%⠬Z7qRWi nr%+UbA|ǏJ}$/fL' B)?3:XERN$x![_e1LliOQ@ DYQST5Bf~h3J nO>eD2I;48 g (Nsn2Lizf|F TS@q5,4:hp]M* e?9R$J|`Q|uqQ=rEC_d;ٗIѰwZbjsqm&2*1pyrj)&;xD`T(u#&ytd_8Vͦi+Q Mp@(N$>b8D?g 6r] L$ZAumut.ڥ_ܦݹbb$jv4l)n{E4C #0^OQCꏠau)֡T8Ғ)TQ1 ~:"/ 0Y8Wりg7rw]rA`e4,iCv IaWDT"m>ٲD0ğ78>AG0xAVc/*@KnIP{/We Pw+Dt JoMxXط](!y[.ii_4:%%ߘhP'ܱyl&gN-^t>;шZ1fXi2eOdܱ%/C0eڮE c(! Q&F &؍^ dAmsjv fVDT+ 1%'*c76u!Pon~,x_*oYF=˺B*[P_"[}/v7}߹lGeAO +اT6qU\-(uTH9U^ATJQjE{WZukPiEڣ|5fdU77ۢ?5Bpk̃2aQaT=ՊOoͣWQ+\s(7&K7US Ѯ.ܞ2QDL&(W!O=NQd4k A$ {>Q%߾\vYDUZBy<}*m#oA̚`t;_yHVXL~H"Є"_`o v'S\U-Sc#ـ7M_*ՕGMm{m'Zvq 7l$mp-ppwE1فІ9kV2QCA{|7%}2Bm`˟~叔sJRWuT=2 ^,$}w\Is 5t_Jnop43_٥St )Hw{2H!PT<@*u3b$W?/uvcQaV h= f"Ibx`2BNxGV8X| i7&)F >#|9|ۓ8mzevsw6fϧT(C=Nelt[D B1ܬb}nET[ҲuxZlK۪;LY՛zjvaڄ^ݱOƼɨIAKxx)eT^ uN9E0|HIx25GtZg#3ӟx:5YiB`kX2ZW֦i fjvP_B]-a0D sz!T<;°k@9ɬNO 9C(mu:6RSބAr1;=[n 6ԥ84߉PA9@g\ =&B2)-!7rYyn)y$\_JS]*v[޵ahN. O֠4 mѩa慦 ҅SfsTy!D* k* ]c  r yC4Ȟ_Z5]2 i.꿨vnM+~JIv^R`V5OiN`!_対yE;9L &Y\02GWV+𚆎W/齇k+[Ua M&zcM>^2/8Pׯ篈fk pE\H,iuAAO&22?a}(6LxmbBUTDt>[<"@n…oeB5H $췄[~Y2]BJ`AYJ +o]k3tZ=E<Ǻ1 %ss rL;DZ9,˴&;%^h iʓ'!Xs*?e${n;)$ߓC 0uBLWWe Sx?PJA=*a{ !Q'nUhd9"@_ 2@VNg͍[;X-Fn 5 Y0qJu`JjaRFTE)`=brLo"?TP&t$-J{_p3vclh:od"(0wwA9?!;H$wj[=8m!L!Z0GN T`%e",i"o(n6@dOKnTo~>:qw5^ė> n=SoXΙ1D\K`E @^W 6 !kx|6\jl 0'&c6T*LȲ%\[>pN q7QItz[; _3iXe®{*O׵W S]P:+:p=Z9,t~KaK*Ϋ]KU~033t1jS v}.RwV6qd_R|^Pj QLO0rڭg:לFBO=:įL#/[6b4Rj6H" /܅hz,˔Yan^Wf'4&{|)lOΉ<6U%^ȭ\n SF-UDf3o&5˧WXxCWf kT"ya8`5߃-Re*F x}E}o.Hwpۭ@dWO"` /a'zٚlXR?~,|vnRt\ QIltԲ}z]˙ zZԫxdD `2C#[/fRpNLY.BOG3)ػýlV[QS=[F10:ܻ}r 9NCLBcnMg^Ӟ|M [Z'ӻ@gķvNYW}5 Cׇut_Zq$Zjua]5Wj=up<ŒoCR׉~LJfNnĹǎ@e63}Y~E~' 0;˺b=5/?rPUc>lvu0iK:+DANk.Md\g 35qVD3PH;ֲ6!_*@x,>.ns⦨Qݷ!atMT\W27@Wa.& @JƄko\P*kp7/Fə}x1B%f7e_]xHg-o~spe=y k[0Oô r|9TFJQ_lKҋ-wӟJ THa3RG9-băb+\)C8[ũPTߢ8qr=*KE NTӞTpVdM{Чp^ҵTwIDO4Z ?TOt)<Ӥ1]xKc rT2ICeM$+'aLV{U uq_̦IQbݘ&L匟tAn4tD:Rb`; 1H S5\RԣRD "șqV 8F&KI>w 7Kyx$0Ca2Zs-> v~ٲ.o<3F W*.F+J}}ڞ>WFqfs{O>pu%gx$8(qw9{CFോJKp~@rΌ5}龶!,T4$-W4׎$6 Ǻ8! \z8&R]kB2TqJ־m>z&vprx4+%OEՖkV#oȸs_>fDoB_9$OT7 {maҕ/Θl|]%-I ӳ$A| J胸h2K3\PŌg_bcs>Y澄s jg̺b(f ZhHKL Dj-ޅLy+tAE##Tr*}80ûjfnQ/kxYaWۼJ_AEA{dVnI*xjF[")V M" EsbVh9px.=H)1: Pn\EU҅8$f(:JeZ=a]>B z3ʇXmp]ZV/ GX鞔ңY*DA&D bKM.3=ul1خʬH-6ԉ ^/=)s` nY&kg4TOLpZ6 pGL}2@6S<ₔTSN TxG""\6||YW6n<ʍ/lzi) Oz B@Eŷ>h7$uq"9Co nHDl c&ٷG %jkP_~?PG&0`WI3urwPzb@!ef#t}-?ihgbj58U`WBիӀ}_"#ԤKTe_'Jt . yxP}67lᩥie6Kni麐ZlyBD$%a!sؔD33E WC4PD* ZʍQy;c.>fs2? ~! h"R9 @E4!}sLy'XLl[=, mR7 :b'%~4hUHI }+,|]=<G-7Aqz#(%G!|[Ϥ^uO?T*Ai(Tn#<̘]fM|.ېtgXA?_~oc ]2Z^=(rX!TnPp\p="HLlJӖw#V_;![Y |әiJuKysx|`&rW4$%ޚX]p۴Nd h! W٤.* o&޲$6\$ZSl(NÅSX?53E>u+ShkJ0;MBx>>껪H U󱨬|c̺!Ljj<Q0B8LGtjgW[a }l]Lbܛ%c+f'$hۗ WzؑOtLnSU Q2>zM;^Am|= 58EhTܩ&{ՁXE:h-+|?&a< ɽ8(j$,4B ZLi*zK0W! BlY ^xA+qub6RQ$cHC.P+ &A/n ht5EQ Q ϝe^Fw Le$\qV(7KxZ=U3 XձnR #*skgoDQjdЁ@em^LQؗXn8ΌԕLsg'q)TH1͍:܂n5s0[ž$VJMw@Ѐ!,HN2)o^1f$OZ Mh%[HT-@KYM8>6% s`msmLy'}oڊwQ)D%Hd/rDE"OhLb GmlH `RmMzlrc'lCq6Q?i;̑\kG>8qs_/ԉlс+^ʄBt6k41UYSE-OV~G=1gbI:a-ulǘ$"i6qifC0m}_0&alPlup@hqH>cÜ67E&V#MU C哺*4iyv|-6A;qY4;v R$TLBF[y7"?DZ%] mA*:&bOHѝ*:ôSY bpLc6MajFbxwe4}\@5iڣ܌Y౔)v f{/M勍7$|(aqڎNJze[h9@9cȠl@Q-7g|M@ [9:!јSvq}H,D^\9>|] /I`xMX 4pu7fEFj<M-#&ye]qJbb:XcAH3Af;/y=d+YHŀv rG~҈N R069θ=73Îy&FK)Ju[GCX wi֞]#%bZҋfvm[d3uNHh~%"q-xڤ5 ,#7?QbKmgbiݶ r'IA3.P&'iovhTG%7*Snw9h![&^a_7@ũ&.{qr1D<٥Ѐ ?(n1 c]k:O0CSᯧ3U;=Bط^O}H5DDU7vk'>f4\U y0  0\ DM誩E86w܈'x#xgXܽ ѿ1ز) Ë!:xyHEf|ebp7(ߜغϡlk1 >Vr8ҁ_/O)2r ]@RHݼ`k=B< ϡPUnct`fdNʖHǎώõEu:иrLC?Fmilڹ4azWrs$W̜^n%Cƹ糯0r{euoO H!6m3`a(_Z 3E1Qi/CJ֋b+)daK BV6% Zn#d|F~`$'I oeq*7+᪰TYe%h2 v/Mo+Ss|>`_؃t,.۩A Dou O+>} _dJ eKf+\ZUƩI~/x[m*un.qy!X1)JBYf h֙"WkԥZrRڎe[=ۋ6X$ߖB6'/y)VU^&Kܪ9dǻ%,%Eat2Q-ΐlr!Ǿ_"1;<;/08:P"[R7'c{sN3N]$Т>҄(~X|lTQI!͢ԴM&Y/gH,wL췠{ml+3qICĠ wuC$CDA|a8_gޕ@?Ъ+iޮкϰ6a+{5@'9(; U=Y,b渗w>So:[Wjw?:&-jgv ͌B*XG%_Aelje*LAטKsKhth.*9C{C鯂6ZSH!7Jc"%IdT97vsܔ6yZ|Ңz !H}a%P+ՍvFX3oܾLrF2?גD L/i^fdFl^lb|I9u;ZTXxkK ,VJ1a pک爠RŶRZ$ EU,sd}WtI :K@DڛÓXmv.hhXZE@T\V<;+)fUQه~=2^ n B38Mٿ #Ψ?xM7{K=tb'ҹ F ݁j֘$hMH]P 識xBd^2\趎< <}X*` ]34T곘2Th\ADbo3S8ݧOqoenY,c7| Lv.10T4=# ) ~ϏF @$ Gr5)F@Ą }.{5"qU77z:ьS7eG]+ iK]BBdBi2sANFLZ֬>'ira㝡iUƍ!3/ $#1ke(o-8AϋF)R:][2^'lzx&zr!>c2Bwpeu1g%;ڑDO_.1u"W2v*ҁugnՈ$ՊiϕC-#jq̞v}!WDW-L^K*F>)U-rI]iS7j4N<oio"4Otpt:T }_@_B$S/CZ8zt '%<{d= iKTI˳_Dn>UH"6t+_{Ygim,  :xFRlHjCޜQMޤd**U)~Zg$23gn3m禞Ջt/ 2@`.CQSۄ wĨDaYK:Ԉvl@%n%-1yѣb~:Qnl{ ztHқ"tU:YzN 8S] Qo zhr}oq<3͜&mE>Q^O6uwcxfz%j@q 3\3&,' ?#[35b|pcɇBn![z z_2 rnG[u0tP+1Z] ]6hTcg!O7s}: ֭̓z# FAW%AMRw }.*ć9Jj $mAkXocB %$ :#*|o="GD6"a-186A<%~s755Q\2:VZC[Yv18f,:=,t^n5Jc'B|re@X )<1JHL\PZG,xrmiAD B#IFI'BY\kD,zLd#燼WE {m u9rW(م+C.e--n :N-dr޷ClPґ% Б}uH*0Uုߡx6q:Z8sN?|`{Sjc\ rd3Ar }׳˱ ɱ(j9C$޿痺AeQKh|apW![?Jynպ{e>-wQ@pdRȝ:`6oLB[D4lSBB{b\~! e/D[5(OFOi)`]ߑtxXx9zx򎟘{Yw9}%j|٪}N43hҟ{r[{'>yuza9 rpaiDnZķ"CL9=IK e\U3Pmm)R،*:U*[;ȵ#XdBM;K&ҩR'y?at;Vj`5J"jɚϭ,Ҫ PIdt1pN=s&̷M2\Wz| nt&>_> #g uu{Ȗ1U XcµfZ"xŀoL`lql2 `+'W?5e| p&6<8!/I'tbuy~ԉO(ü +̲TuN2]ۻlw>bTwꟿK&>ʄ!z&sJsueWwB#vQ0袣QY1H0<&a#+Gv$r&6l&wM]{extZy+&.koG Lj]I Mad ܧz>yzjHYsToNZFMδc];h3 \7շU/62 _"v qB  ׽o5z H MxMg#L<(M55Cw)7a`X&x9>w3tV}dnmO"LHrRRs9wV@0 ;tSMAgg$!6LFfg̈́[ccNk| C)0c5 ypQ![r>{w(hFH:HPjgj߱Gc>luXKIbӵ^k[[Ѐ5r},RS0bm7 b.V6cB6Zl%)+n(ҞO,o C$j],D)Ǝr{s@:<+DTOz#mg-CY93"J-ʿְ>۽6LA 50_@Մ]|2h\^-H0OnH LLP^8@(V(5Ԁ)ɉ\\6-˅1QY q|wXHAZ̨!)Μ((3(^vGUKɊX&C3;V2PJ6֭uϫW M j3labv_^ėVRmRO361F<{ia{w`(KHMJi&(T%  ^Ϻ= GPըNaXu 4 $ض>&߭.t hnYH,C<:=!ihpm|pO'CI9:q*\uvБ:ʆTV*뮃Pf|C˂ vPp9DtZC΂;P+@tf+6K#d7ϟ'PHxgt^ιNht_!$6\snOX\gGu/AW%w$`; Iy%%OR_pA?.&#qK`;҇5*jsxI3-g-N;<GH]I;;v`2$交T]19 (%yKί䊗Rx"BIJzw{3TԘ+-*mfiqniɻc0pJvSui$:_vOVS˕,"zqdo6LIrcg/ ,2d(P#b) C+D\VzN d =O@׌^JIsk{i=WЕnmeû3[V3))Jd OugN1ߟ_ H[KFQE]CYy' KsI=s(uaϙP/f=yJW#QtRi]pKmC~ж"Y BVͰ6,-B7%U<ϙ/&0Bve; xag/ 0Ǒo&h**fSֻNj%% yYӤH*zR ؆9|9f5y>`iS||a'e._\>ECNnǸY ڭ XsS/CNk#$en]kZ|M0L b6V{q/uf񏛅z SX%qvۮF-7C4K[}z;-58SxftA&UfmN ƒib#%srPs9H=Ҙ6NF~a8=orƣS#>XޝG(TdЩ8%4.ŌN>\ fAKX*j`bݤX-[Ի6w;;74xX`w\9GM1 z-;L4t˂YuEAXx'\?72ʲcWYP"say7_?jK¼oTGfrő/ #䀂`L;)RiH @LV(7Lw+"z*DG=tS+%޲oQ x4ӪQ~A&EP0ZӀ)йwďtpL`^-,k.=.'{b*P_Ѭp~U 'HHe" R{+}\@+9Ue*&E]7K+4^~,9yA6PAXH^0뇎E yvwq7rr!ɏ.']uMU ~!EYOwjĎvdWt4?Hw%pпd0q@*{eDhQ`EYd,mQVf6BRbrayzk wYk̊r TuH^M'w UGן̫kDW;GN:yO̟\劁l͠?EĸrQ = 3{OGœnI ]:\$u3;`J9*+;mY}BzCk`1j"l|L!Weۤґ<, 5aP2Db\ rl.wd1C܁SB,)w 5[V 3g̜S?U,тX?p\T4&NDN9֑R.Q^s%#'s]Lulm]Sc ؏l1V5usF+3'$>KD)&eG#A?m8V5r2~ii?_%h([!Hf5 (u9LF63hT|#qʚmPi._Mr` A_E[ X  x"o~~폢e( BK W t~NHMGWbɭNOd,,X᭳@N/UAB]WQ_X ^xj(*1p(aRW9ͣvt%#,>Q&\7M%.p\E "=UcA wJƁ@2 Tmɇ!ǻu#ֳ%\nJnuOCٜEN!cBƦoӳyӢdHjc܊z+e@\t-pA f%)%2󝲽Ft-L\וGpX4#4*  {phJXlW/W7x3 MzTyGб&U~Vve#Fb6: .A'&QY>Мgg?1!ܙ} P}̟3F[a q!K[_8#iv򠶃RcJwEɂ!hY~Q'NA139ru >4:dǺjx*Za03E΅$^4ECϵ@*_+H=RS|q^4-1–(urL~|DT:Р'K4~_ -'$_^~AyMY9:ô>nʁ`h'NlxFWEFػT.糖[\cQj8ѭnG[BTTvEcXxxO#%0 )7#FSM) RiM;`n { 7 p }`q'˷DvF< }r+q֢h7ⷔ5pILe4"xn~x,2e> 2HϾ&w&^ۈT0'*dh]w`L\RG\-$8Bg7:aq3ߘLoi2-2~NOhvAwhϻ9_Tb:"*h3{xp>`ڰMAa  M@\etmx!62~>-#,eXzz#/ M;VŘNXn-t h@{w BdqMN)uE!ҏ@^ 2ӏ\LEj@ǺܬfzdH*"YjeIAٚ9{3Q5lfHS;QL .%Gk11Hk>V@y0` {$1Q,ߖ.\Dyt5VcˠY]mH(GLСSTM=u``)> %wC&=tnmF=^&nFA0<RUq:}˛^^L%ͮBOHLg,9Os_ֽɭlxaX.bWS*Oq֝l4 wj*YVr\cT0bE?&*49dhw|)&Ղ}aú.}B&T hv$cFTmle[iqF0MѓV3ӬԎQAO:U'%vႀnAۊIbv"**O3";ߥi||{I޴):}ڷdZ?QBXI{+/=t.מTjlBvFpg $ xa::}듑&y`jSw`r 8DD`cuXwH#{3_N#BD “ daD$,i$6m3@?*Tr8}ǩq`0}EgcV FkQS×IseX{ xb$H̄WFR8YCjlҩ0eqw0D\=i\ [sk >pw}iFDt,C#ǐ >bݺa<ƧTi{? Ys$d`eє%.ڮq3d›/N2:Rf2ThoҭJPՆ3f>{UGd-QW7.m)G4S<}Ӳ\|q͸ ZEF '°Kqi,7 pFgP/{Єnv8;-/R6)X!NO #N*J UbS3pqzu$,]ͤ k2O o@2rkc7`2̤,FmyB(=$6n/hpDGy[c+Xhŧ Xs jwx`9Ț3`r(R:¸?n#%=y2Bz/v*hg:Ŏ̅栕][ ?%(E+MpTG8tT@k94o@$/OQ9cڈӃ{vF-'mC}<ӱտ,Y.|,T6WZ疶]T/#5d^ r}2٤WrLÐ&Tr?NʵrQH/w6K* ^2M/ 5T%vIdÊLwRyֳ0Fd՝Zu,E@1jyxmK87p0TtĮ:vs.Kɒסܓyk$Y>&qGF7?1i!t2`\V`$/| q* İqtDYuio=-7Z1irPy @M P:Ȼ쑖+䑞iLzgKC.Tz\;K+,ĸLm-zf=g˸>65<,1ex?zա ?Dt|biT>]B\cjN 󧯜WhYV4}yI"S:oR?SF;5m݁dA}zbgS+/˰kYŗK@[|fEAWO݌Bp nlT́?SZyqIG&o)u!GF,b,`Q&`qS-|ϙNXjl@:.VHY6pAs=#s9Vk(ՉHIC a '+3 /_wQ#ZKjҟMz"A#Ez܏`y8s{Ŏ(6Qά/XsN=di`>,WD|ސg$+x̩X"|3_@@{bn"+W5;#<%9Yrr\$w[ |x M/̰8i`7-?GA(DJ"X ЃUΜilνG?Y6+65ɝT&w%a 9&_`4*%̓|qHZ|r_r@Hu}-sTPE6,zYf41FeS6\IkˇB;yPd3Zz3Ɲ/_M~9H,[:7e6`}O@ْ7npK`m6;_4Hpe::JmDs, _׾Z>d "u,jv"i/g٫nzD] "%†ϐILU9Nϝޤ`>WS,s)?T^̷Htgh+4 <LP W<\pUr".9s7_:}é61' 7rb̽rұ.[Vz:䒎"TBۂc_ SPs9.<Ɲ&}YCAk ]=[PktʤmH+sKx ʀmXOgιSvkq+(艃|:1J_P%) Df!Zw$rʿ㻶I#fԋ S9 2WzvP !ܡUyݢ  ׹gd 7W^|jO*: }B$ʙOC|(Ǎ>; 4 cꉉVy3OIW3@HxNJ pLAf6ճ'no\֮ߨhE #1J3{FV,S Sd`dhkMPesψw"ɜsj^A࢖m7h?_eӤ7€==MeAnG@g|\)()cژP!qbY:Δ+*=q 6o6 ~l7J +ڗjϲ9O]"rk} <ze^}k4P\}<=) [h.2|AA`?\S%fDoǥxu.T<3U;C 5ys|ܬxBWS"9Jmz(㍾0G'ir1+Im\ [ё'S8Y~}}U~+CEo]YHH0pB^=39ecEp'ұQVġN#'8^ ULA9qR(_|Fe7@+7 7{>C<`a ^+ {rsGa5F?-|tk24&%bT6gK4Šn[WVi m5׺tRxfQngY|N,Zkny_ EP,"?My{jAʲ@5ru\IRl"ljU!r7X?nsVI3Hސ+iv3^u־*QCRIF./Tsu8orHoo1oi1$;X=l{@5liΨN%٥"(c)>AT%HUʒwqoz 6,!-Vz$s &!dQ1 X33/CǬ֣f Z ׃vf$я}"0X!r'RCeɥuou%QfaЊLr AIjwB$iG=? &SN! 5N/ܩ 8LO:׾D4 '>P닥n4Ev'foz%wM0q:dvm:X"H4y'I饐Ay@cϷwB:ȆzufZ}Pȡ~]?Ж[9|?~D'ma!}* a^bvMG.$eLEG鶦1ˬՏ,W?]cdF2HHWp-:1{GVx#HMƽ 쓢pv1.0g6xuv_a3e!`mtkw|.fr#a q+F`oy?J 6^{vO56Y# 5tMr 3hCըclG9c]`V1I%Ф057.57Xm`DVU` J^O3SŕmYdt:Ɇ&WKNY% 5SN:`Y80Ҏo=l@Sq437pˇHdi\8C2swW%;tQ"> xJq2ӊ悍d@jf gSs}H/.DuzJVc-̚k F#n@>$<,T"ae6&a!Γx*ϊ`Z;OLX}=oeKW\YHm쫗 LKvI|:cbo/K#zP7k8{1fϲT%{IS .Ǥˆ$m3omCO)W}lgqD` 8%S}Dx% TΟ`JH۵~PW8 ʭY#ג;_'?ݎus sۮj6樨p3-;:ч}ڒq &oY"/oJb|PhIps slʔ2iߒnq}t0}"p"I͂ی/(0fuͳkSܚ{Jr\Jl&ѱn,i!r:NLYq⡬`kO(Ս  IXoP˘ͳG>i'UIvcILԺMBư. Wk6܄q0^*Avͤ` T{X1= B"EMCjXWDz[{\h,_VO~/ڢSzkXy,T 6GE?lF䬫Et +R*9z2{eϲ& I]؛I_A֛}\^-MЬܑ(T‹vz# ;nJ`=Nٕ]|k=$)%beg7;OEET4xobNL [If[jN\ +_/_Y[ӵ~S |v&'0tΧJ,q/"o0 ƈ !Wu2fte޷^̍vvb^)2u(\տdց!;! _\੟xnn zȥ.D`@.75C݃Tb>L5?bq=I6O(&:i@N ʌbrzrG@MZP XnfEAǠ.PYZc0oܕhMG;?$ٱ_+=HY)tZ(qn w yu#M 0L'hI+_*]Cu3~{e (>ĒbmXxoFUQIu5Y Gھs1KeR9;*.~LK6)Ldc{6& $Z~D+rwuAbpx{)>T}srC#qaNJ1m`A|6FR;Kp:gh x ~.X,T+YR{Pb6 n4EC9L][`hO hi"?wĵ2"C8: yWNj|;ze-egX5'[gB[ކuSs`,ҾP[mN&m0Pp dBm9^թhii=˔KޑNCl_g;&y(Y{jgjw3OSk%5 Gp bXa-YA If՛Vz d:p(v$ tB3qJ? %Pm|'wՈvEI=y6q⻛%@;b世p9Mlv4NepJqx(7cl^GQGE%`MZ08O1(L+?B2.ʜrH\G'Teަ{^3VCA]5ul&"qYb ثA,"El,ȋ >4ɼ$j?='BA pǖZ;}j.ϊB+QZFWvȮ[{N$մE̪ rfОd-R,׶KVwMFr[djq:;6m l OB];"kfw zHTKQnƉV?'fjk( vWUVA퀡D:3 XaCN2BuQ&%RB|aʕC )1ޑbULvGp12׷h%^ =wI=`ZL@7z"*k#u~=g 3 oB>jQ*rMkk  jnknq@Rg"QUyD%_r3F<B nsEY#v%{!\9Q*~}˔3ZE' yI 2zam\)a_򧗊Vsa]?iGz5ħh>oN1>r[ò'a\f17+:I85pR@V J-r;6f A-uf_ߖڻ圤K,:ndOj{{u hx"?'OdXD?j#Ӛa$p0:3øa<|ޙp%yMG1 8QcԼ9?Y"Ao6{R3;´`smϵW ew}B2%?J&j7ިL`G?N# -h^0;W$5`U(>hb?Sb|fm3QN#ښ##]VkZH[\,P-7CĶL`?MT)2O q|xXbqqjA`]ib pve!4 fo:&RF`҂ HTIX[Fx'{ݝKy;i{K &׺"VotƶJeGnS&b|Ja)2"`?@`cO+Oi1(M96UsEYkJk_tK]VPbRAf~˴tM_}rdX\`*8|m6%mwC)W-"{ͫ/tiհqtw:u7KC|5%q)(bC?V$XwoZGT} T$?qmȨ_[8U>艣(c]+[mw[# XO}OڔUVh[k>CZ6J h:\#,Ԝ!i yU5Nɣ4kuX>JNł $p_.s`bt6B Auz20u򔽸`fQ< U[#o( }wd`BDfz`:.L=9N NV'}5u!>> r T?E?C=[Lhԃm%Rr?A}Gk'04E۝N 1,ƙ1(۫x$ to뉰\1I2U$yUfbK_<΋n g?lGW ĿuZrd ޯ({ٸ j JUʇJy[,AUWCN}:E2b ț%;Pg5V:qt:rLSsf?8 2`֞W/j"eMv=94|YhY2^ 뇨R}t\NV xTCＰR3Qⴹ^ Z*A".aX(:{=ީF|u;/(W;HDƙ" N{2/w,|c: GvjIƓϣDkZ+a0I8(<;tOc%n ̺7rTG@+<`cJ<)ݕPǝ^t[tD[ǽf(-F$Q-- p2d b,b4H*ҰmS묕lw:3 Yؾ C󤄸wb@ }0}"QY <vC%-_x~4W7C;Q_;'BW6Ck~C|zg~W{W(1>C">}z؝fr܄RE|0Tu9sBOl ŗX{;|\dII[%|H87ODEZtx8D) e ADо]%fәmuH:fT7QRa*&0&TKm,t$|֣xQh`C6~9ʹ"\mǣuȩ}3Օ*xcf c it'PiAVg]@n mJJ@ͩ֗&c|o&y@s¸W8`iL>C(C{rE`[+G;%1Gi-f7G*#A{x{F c~5|Fn؃Uʈ z:KEl *S;0r1SSTl{uAXBw]ٖ@:u1vl 4{&^K_Xmh5k [-17 _/֓1#zѢuj(Y-1X&,hk m]D3I 0ם'pu޶S9$w@7?ĩ}S*^_oҽ=e㋚XB-DGs:*E{Y.~?7T`ͤ&r?y\)9cWYэ- Ҏqi dUJ-o=|K5mNNfV9Zj$FW-OWu=K AGV- >j8,A@?U6YjRQ3+f׋yφ*7r |zǴ ~/ z#1A&0d jDnfq`y؇͔Օۨ|C^rwBXDA7eTPmgPA;өwU4N4C~r6˘~=f n: CAAddj;P:.ݜyi]Q`{-lG\`פS]}{%H&aRE{lЕOA[)PK (wĹЀ~"5\:0.l Ekvf̐GW{}uhM41Lasʎ&<v?2N`[ Cl>3l 3 HEAXSiF-3Ng=sKpyELbtȊ790xAI;̉lT=$Z"H_IzB2}6 Ӏ,mͫ 06'¸V^$݉*00F2A=g|Fz*VZGߜƠk5TmUK;r$6gM0u2r,c`ɍrK ;a09?Ԭ 6 9Rx2^I9@Tn:cS n(TGlC!8CR˥rե߂M09 %T$r۵6ȋ7w7j﫰u1$~b Y0 h%6 |uT#o׉ dÃ??e z[ tl zy6yb?խt[%x?G%pe UFF6QW_,nb xNJUscJw Φ0Zx%W*eh@7|3D%/d0 HѕdgmDJBt}^J hWhi-U:x kX4jtβ!FP+ss4si|d)ޭ:e1'&bwM) Q*!4a\u//>AwEAH"23R ׷5&53 *[J1<.dQ3Z :X2vQ˞*]Ѹ+XMK%?-QkAکW Y@iv-!؆ Xk`fXMG __mVꆈI5KۆMQme8UV %B,:5;5&Μ PZPs2>Yinyx3bB4` i%zxi5e*mz~%hoפ:`[;75Z~]Ƅhjn )fםrՓ71T+ٻ_KZFj{?R}dwdRyXKe>H>1ZQh h>cB|;[}^oʣ [dzUPq˰3ONhU?+9,Iy8`- _o+QŦMt 1h`p\K@RF 6&H6F+y[ۯ{XCss|csBytCVNג9HEj+I-Z!{,`,{XG"wys uuŀW7Q7C}%o~03xY^ۛ z&P%i[جZ(U9Eb'xID^z/AGާCЋuEacHzX=kUoɊjXSYjrԱ 62[k $e ^r[n6IĪ^ByN/QkF"=ϼN$tޒtb0h @vp13ἧԍzF2v}s5W`uXlW4E/&C8m}*:?F ' ]F243 5>:}غ-_\4LgVsnckyt=э=~JTSv Rd:$gϳ4׏qU> ԝr-װPCDҪh#dMMBP˒Tx?rWQ3zDa08-QX]oȔWlŋ#WU:}ٝ\" QiLzwl)iwY iJ=j3ҮU^UDl[ +I | R`7{k+JHk&%i¯k,H*dDύAv?$J}9)<\x !t옚(\)=f@XoqD L- *(Y1H, w]w+p^zd)>Wx$I@(EL_0g'g8o’ ^~ . QiqaaHC K%תomxlq&NI^Qh]Jr1³1U2$|ԝمJˆ=+3qb.C36XVV ZN!t[e]ϳ}0lZVIBO:8c+Khb|1d+ѢҎY_ lhERx2%kס6&!3aM1Uxax D*8f-էXGx,940*S¢eDtO.OpJǭXKr[ $=v@SpJ(3c=Ej9W濸fx4lAZV:iP䟘nQ)37ӔV}ٸ|s;nUZz(lSGχ02Ui*[NF./zPe`/\9PR|PМm|FTQn] )}f Aa0_Rpe!{ؓ?v+v$Ga/]XLͼ`"OhB6jy@0|[#"巎'o(0QNSɴ~|oJ .,Q&k*u**NCqe"xz.K( w!G9ڊUl?"<itO'sg먆[ +*.dKYC,>y]JwbV^=ʺUmNT 8_xV_Z_ʚ)-DYHwf8د3uXm==h̀dJ/#ly-1'eD PqM刞'^D5kV[X$Lf;LvēȥhI֏g R*%+0K` S?2?kBͺ=xbgoqn`HMnge9Tvfʷz݁ [m9R5Aւ&˯ QۧI^?u{:H rZ'^B`"vRdwZp'*>lRy\IB3HS9qdiSe%K_UH2"(:(k\Uw>=EmTA ISBz_d9;94vEM:`*,RyYM:2n=}/C06mHxc8~vAo{uVTkI~lrHz\ mw~t)Hgxvhvz!?4v>0`ޕd4Hdx+}g ߨwËGpu&iQ7或=sSZRPscx\^#;_tqT O6<6@wPJQLq(F(-Yd)E8jKT'n .̎Xs$Jyn[8;kY;m^kXy 4^ 5Z5$s îN4$߻\U*3(:v9!Bf1+7(|^m* qID=/  E/h09U[!c0); Je"/qE;v|UosihzrV!.8zJ "Bs?ڕt ET1xYv)£ o,Ԙ b-W\й" TrV 91*VDTdJW槲jLAt_N_2^T˟rm6]_A6QDOe'z󃻦.[bA_PEyɿwxq8ˆ,g! %2Jw¡WnPx7d<5b}Jff{Cs:N qT$J!΍Yf*b~ Mse *,̼6 [Y-滝8~ \O+}L@<g&uO75]O&HT?m[ X\Xj³A֝ QIkm,^0,=u#B1AqB'5G.z7$tOXX~_zG.)\K_|ieP$u$h4b *U0.c\hqyFfLCBևڳ늞vqx e?3 rH7Fo=vS z;%-V\oD mC(>Bk>y},|.Ye2kDáG($B=E;C Zg.]몙?~nI,E,ymn} =#f04i4uvadL!aðڵMmEoď8zssNqܧissID;dw:JUs`qy/l{10F=2WP]Dq~Tl 5 ?h6,Y)L구+LtrQp*NV?$qBeƅ-H5S{?\+ Н,ϴadq|a)?$(ZLc苞ioCh'2NW2є4 #5y<:S1N,ᰀv 00>q2quIGNP׊f.JvHDӦ_i Bzi\M3=Ett ye-F+WD8FAwқ9Ա!blZW\$bҘn+3c6vQ HxcbJ=# OT {`F畘K\}F) rsd<X%Z3{_]J;z46DKf)~ (V|麟8$FqwtXvE'PX>LycYF)cPUkl`aGwsx]hI(|?|S9JM؟\P'߽B} 7ߙ iofKb!lqmPZ^} :S|(#BIV'Y~R<ۖ|dUS-|vY&S)5E}q%BD,lӊAlOݪ 5I`3)(x ^T ;0oD8-]N#>,.z劙~*cKvK]ڑ_V/te 9w !}bE'=jZ+%G^ 1nN&9>Dxgc=U_wQ~YO}wfm8iwj$16q#:w~-lrYNt 4 [VkP3,;#Tx\#u0[JЪwX7zuWVƾE:8ss|-k}?z 'ٯ ǂ>xOT) [0vm;TRa {j-l={"fpi <т>>Hj!$-Vnccb ۩p6B3ldwꙊ- EG@& | N,qG_y{ʺiP*Ń  9^ݣՆ:`Ax ]~^*5R43[h^){spisZog5tXI97Ǟvp0M֤!Ѡz̵@ ~_k?VfGԻXb1Ӣ쭏7(!L!'6 sjf갽 1:E`xgQa?fdЦLJZ$ Cօ=:bL{K.5F.)2y+ 38L SJb&):GRx_[h% ܓb $ćL 94Qա1[: iBMsv|S($i(j'~w~X {v?"X9}der*l̚s0wk(&kZGޑ!1ڗ(~Ic,{aITt{lam|3PNtlf$ 0VĢ:~TK®裼UevjSj&iE(]F>ˈW== I(~W -dܺC:$T= `)O`WJ5DT {0OSH'N>|l%3k,aS%OwGn̡i­ʬNFˆrIҽzw¼_(Xl ›`ڦpЖ }UI' "C_"S3Ҽ1zJ69QgayO jCď?Dpq0v9ϋQS;󤕉Fee뗊jI5X_F|t5>$UTUk!6>"*L{H>M,rK]G[\'N1DrұJ0#jS3D%5uѵ P%.|Ԉ>wt2(鰔o*fקC dH59dyyɹRL6' _v$a8H Ի=c'%EW=Oz=F"#'4߾WEKkbNFCNdr#fgF'HɃЭ63tdtGgah? W_! Jꖚ1 Ǫ/6\z2e{Q *BtvNkӕ?o$ Ђ5W3`z/j{\]M6+!uBB@O9Ap/ݐF0 +pF;鈌N+j5-3rSޟ&jc#tjbK{k_dyAUK~ 2bJ!}+mʣ0 kqlW-.=Hoޕ₂IbQ(P,y$U&1ԙ2ZoZ t ~4pӒRnA!ׂ8%4+Ɠz`PO@bd@B@M=Cm>l2QV0g#W+K1("JP~Z -cjv`cX Q'H-GTN^ AӦ-@5Ӿ"eP@' wT4A%O r}GvFsPCƼ"Ћ^ b<<$bܭҳ\$G'_E,ȿ2zJ)1F_1_ Q9s5yMe;ΩqJHQxꀽYq T/=Lh Q6s:J>ࣷ"NK' ^wۻ]wa{1 ơ}S,q߾{ 1H2]F^RmZ~}-v3qt;o[S IW1`PHDv_QL> |TA;FXjM$ĩ?Jx T'A >Xqk%-/o'ufj@b3S!*Rmъog Z=V+R쀭D !WmlkshX\]E-]N9 0SƔ߉ U"'^Uȿ$> ɏP[YrO1?LGT<|ǟ`7׿϶KqZgۘ&lۘ{?,'shAp=KN#[bpF~o?۵?-^PqT"Vl xVhI&j׌֣6zD*G:Ct9*ZOfdtmS &v, )AҔm:VCAXrM}-ݬ(N%Ӿ`4N0&)k_~/j&meP0x)-].s3bEn*(nעo>X߬Jxw5V!$8 @0~A'`Vg6}|<%]Qȧ%]gUZI2^a_rynpbZԁP5 z^-T3>zw>(3/潩^Yf#?ђȗQ\rV8B\z`G| \)ƌ1*t#n`0! =Jߓi,'OǠNJ6N>PaU Tzi QX)_?:( ivZė y=ٻ 07WOcj6TcfaTCJyz&K׆LJS`_Xj$D1_hȺ6SdDrZiE*!1]~tpu+Hbz> $NifY*,qS,ݴ8*}$1]7n\fiB %ɶ/aQ5f5ӇWʾK. u;uu)q{*s ޭfcݲ~@ >P:is6isB \_GxCp1npzEBE< 悈3F6f$#\9)Ԅ0@bŚZiQɈEQ MVjapUǼ0^ƻh>b*Hk$+ZIN~ =?U27wR J %]X4Ze^D2_dWbMT̓ހ~GND*1~ Wըh9k6m=6Mե)3Ep 0bOf;ZzC10B3koo fg؝*4ՋEA +3lkaY"%We\DN !d8mt)=hiNδVWtbw"oA!DIG)D˴NZÙ,Lb>SJ+;4w kdC&7IjuqT,F:_ ڭ&QLD&˗jWf4xvەڊ"P &gLw X$$e$QTt',r2$滸.**G>*v}|+ȄfI+24ޭ?qpkᬧxM62dJvLN5E[d'#AQLgK&Sr3Ҏed|| D¡^8,i`k$.ê٘WR4mh*TZZ.J!RaY@&au R^^>dAÐ-84@^ؘamһ RT`3՜]5ꡩ`&ݞd>sbr2FmZJ0,瓞Yt Ch3M_ygjNF7[uiIdf 18Dԉ[iQ]zs\*k#A^g3F꼏ZP53jovΆٱoÀ<\$٢IkzG*^QotN*~cϼ4ba̤eƆC+mJެ%= 'w ~i|qٴfQ-2Tt;ؒpZ9/Q-۳i7Y"|mx|Nb{;-4pjFM_]Z, +({,ruFЉ7JY}~F,jؠ^lLW9={W[`F;U}su}ƏŻoyٕYsθ*^DkZ钯L@|qa;rZxDe(~ftxI0_%a@ 1wwf=m)T8˩0`k1g}bNUIrX2yT,l8ԩ`*Awr"K  9i~D)6@B s`]XR(+QnNl+r,% 3nm3B ;븜+tcflrxT 4P89V*;"nkG#S\܉֭ۯF{+mOIOȜa,Sq<K}_N F\Vҋ*i kh0 z*ZVuK3J- @$\p952UdX0])x5y'*I-0ֲv9Tu_3D BG0ܻة\ݵ^KFϷâ/V^nbkWE;:K0s]"ZK2g WyZFI>>vc)GZ*_nn*GvvC1uN-a1ed8f,K+$`xó p:Z"|?P~&-CTcWz).݈s׾PݗעӼ{{B&)A'.1."I"iƐ.C3ZC>GdjntDa&䡷˱`.n֒dQ9^\l25 qSGm-D- :!z=50ugeC2v9ڵ윭!+g]#[ Z" _ d7 0} (B=1(: ҿ=P>+ZVJ$'L n3Pc,Us4Epڡ99l|f@vMb( Oeo>.|^n"^(AS'SGɓjk ݠn4Tݷ]Z/5&!D_'n-*!ZLAX=!uM1O:ozsp7hT,Bv"!K6Y%=+ 8ضr'QE!3'3\ghB kͶU[@F3DFű%S.=qj*UW"J/l u.z4Nm?^wde? S<7vVD 'mع)e8;ؤtA&F?+᷉;ELb ))rp>C;omM-ͷهt B67 A=vZ Yf -XDC7ϫĞ3q_g=^k lv<0:ͧ:2#=o"H80.h$)+YŜ8Wi>$$D`0^T] 2|ϑ8c7 ~.X늲mmK܇c_m5)" 0Yˎ(^:>ǾBAL7]A}t*Rһ>mbg998:L+_b憭aV d7f6PO fDV ,}ݬUU, EO% QUV J1}>˂!mPHEVbzwmnG L; H0sڸ~&sy k4U `홣Alj5#'ԃ*,aRPx6AiZ\,krw41 ρݞ&;"/]cL@Ze-VOZ_^klp©k^ц{Dt8@5˅Zu]"7:uO"fT6/uTA&h`Z5D3IefCh0Joފ@hgoh:d|/s*Qd0 Rp ڱyT> G驴g&tp jSE",48)~D#&R3,pjOh 8B=$#ۣHA8bE)^k:d%<-dd]k3Tv!u/ϛ+WU@׵dd0!hoXL[p1eaO6I\A $H^8[<P/2gr ln\ſ Ycf4US8pGRԨB)-v {ʕ7m H'99=ao N̐!k0<̷|7 3\>4m(!;^56clI[?N-zm"Wh{eTb~G{E+Ůݳhxe S :Alro9= 5ȹ &kWL3A[wiS!!E@'gK̨ZCu?"8mA' lx4߀x|=J{r0W͛˯o, * n'ۧq"opm LZ5G )PƔ9C*,<פkƖ !N fiH "A@@mjG-W${uYU@X&F%pC>FA^ ͦ[A=غIA~})Vl2p)s=B}1  ʳs3,xcKX<+ዾ*8XH%lB+m0۳#`tLU8pqH8B~ ڍRI+ 1UW+`GDIq TG.3/Ⰿ"=y^{ݻy~gʑ׈x l83ʵ"[=k@}-iGUk;`t2hj*eRBCe@gK+~TsR(xR-«?.Cv1"@ :آ׊̹᜛\Gi~/l5ZTQpLK /'.濒o֯ '6\9Q7g~uiQOl`x`O&< U9{yTlu=Nf QZ:=7X! { uǤSF9ec\ T>g9 OT.Z+E?j.}OSNpq쑱FbkDZfǺPFF1X;aN#gi+B`:&]pFu{`)3y N-B3t+ r]"D' !3 'T .,8# Ѓ{9W\۟X;IC`ı= NiI`2!~1wf̚vMCYp<^ ޻ `#! ;p!I*^!c`&rȝh,Ac &܋]F,,eݡ c D;0о_˶1]FvQG;E7z2 Ǒ\x蛜LN$fsྵgrn$ W8odcxQ/J$"Aso*{Impաw]\بqNSiʐT9^C芊XlP[M?m4F$g/nfvv4Bx{5Al~Ɉ"ysE3:;bVņAo< .[p#FaX@EnQ@҈fFs58,Bb!Xdvzɨ}ⶫkRA3a9Y#('l'<@!Etg× /ptU鼅8֓6D~5XR-klB/׽,˪^>'}ϸ .e Uq׶t{!|B_c$"'$ OXT1WjQbDG~ݪ dJ!EcPH R4.rj~*-l*)W^BgƞM. X&)K qRoټBe_ޜUAq8ޙ5>+,+W>!1F3^|LBD ;ۧR;P9d$D .'I}6+8,>FmKx !woHM8kvc:m$ 1H $%sz/?هz^NߺA&L;tX5> ߊ/v6f4:ŗ E:}|1 GR +BB+1qe~>_O;bT;vDl@H=,#x`;aFW "uvMj<_j*ە\0^1M^J};`X۬BCf T;&jbSa ]2+4-6v&<"*grș}#C Kw0n# Q}YyB .J>]mLf񱋵C"s|!"% v1#UɳWfhLsTL9~1`i,&m:3p\S p9^ „ŀL-dT-ZF3wU!J`7h{0e: ;tHD(.Ffm9%"0L0C1vgHcy$5#lّfg5ZF.r'(Z*1 @T ZijĀ߳ ]PJDO@s6*lB l9rُ[9V.F0u+# ]< 1sUJ }Tђt5MoעB:( `T#V*4T>=\۳=hR]/gh.UȀH",N0)"Vɳ 7S v Yo/'iRV9(˜:նћ|3}؃m[M0 5#GTǦh"ƇG4,A(WSb-@MHBI AHL;E0)bj{XEZNMfP {wVPxP msڏYwը*izm[}^*̅$S;ms@ /(_h+%,k5|~OP衯I9}'z P俯2\#5p( AhB C,3e2f8^hAN%A޳!R9^bO#yAݤ6SY~{nfz&>bwT;McfӇ{~;2%EX&AF: Lk'o?6|uy=L v!B>2rs탢ACd#Pm` :2AyAK˜mJP֠ ȴiUŰ xX:Bt9Æ`ԓ>dj]{HA$ ā1{ʬӼ̩O&)_òT^-oo*]T=3˿=+q $,͚%$_\P>ÇC=ŏ;6ق陹?/ CQbݡ y!3@vQBp![}G}f̛Pze07D|ލGwA5آvE_w} 9l,k++h?SOs]UO\6$MWj`cɥVVY7tF^v=HN1ӦT1e"loYQnɄ"{:b\M]OwOaN`pBﵔ) yExlN9{ʢcߘ..k `PH OkS\rӦ붵< sgPҾ,,b)t* * (Xb)"鄠== ~-90jZCg1O3u+2GhiUgd9ީcoGT7刾 d뇎ϗ=GK (\% V*/@7~]n|wIP|Q2{}y4m-IZ%MSd}qDi[?Ipg`dDfcBP@JP9Hdݴc;pHgا#(w}tؕY]duDG  WHm_i^-LF~t)/%@ B`^N֣}EbAHW*6?;zbO !! 4V4)T7X/TxrJ)3fL;܁t~C3|c~C!Čs4l!XsYoe=}ޢm'`,-$p;y%{(t. y4+\$ 6E=ul>/[=1ڡ)csk`9ZKĢ 2ܫ Vv6NE_5q8u;@)ˤbw>? My*bv-S=;i,(`UҭcY/qO@FHxi7WuD"i(qJ<~Q-bH$ͼ!.]uaV[)Rjw21Q` G6h s>3<}JO!RL5tARSr%T#FKe3@Z3-mQƶp1(D8=<".bXh$r)yP!D[y6*m&Cτ4@"d= !% kI@"a ӡsȄZřLZZaGe""eT9H*T={e#AwǦaBȂ٣7ೣP{YKLxmr8?L}ihE62ĭVjK `Ϲ{$v]zs.Jf <E&|4:4-U<+fd?Z 5Sv霟Q=˓vt\cަ㮠‡tOrIF%b JŴx%F4h?ySg^u d(ǃzTU8w-(W d×/8z ATl3tO4at1GOcCꤜto8fwx%q^`wLF𘆑e[pKR'Ca ߠ}Nfl.1m1؆{G9Ii?:`S9/WF6X겍t0DUĪ_wh̥"F" WJ*YQ5E:`fX[N["c'6y1ƞ t61h'Yzmt!}6̠$*ѻH-jA4䔡~ S]<JU(!&ggH1IHI凄׽ƤLOdtkdem6eu}@Ve|xƈb9H'&A/n2}ju_IDMEuW{H5yW.0BJAhiXtѱ'Fp%$u|i@$es9'g4O6Lɋ=('IXwvjd0nia&,G\ɵ5u8+5=6d ,2ݏL+Zy2k&zU$Df|lVc(8cy8SC`qÃާY 4 Dl΀mfuo}cۦ9XjPC;w2k-e.)xt/wXa;8!!B||{!{}60Cuǫx:U[e67xMhGp8 PIQxDKϻ84؃㫷褠mXD 8M 8N,J[c`u·bf[:篿?jRd@}nysD/gz->Oר99iNŎfkn~nkBc,L[ ߺ~:˴A/(UH[/A⻢-\W)dLra<17oA,uAfZ%86PbCe |"P8|UZ h|Uo=@;\!Y|ƏcT6x#ِZZr/8z)sҼP@Ce^_\'L9Ӱ.xuKGqIm[3:DiiF^wQhPGF8dCFv<ӖReJDD,"rKJMRmgNr&rScgvU*)Rt:3^Z!H-X(=OG[-rTLD#h )y XaJ<0(AI8]eXDֻ<ӬMftsu໎9Siǀ՞SlB ?Ɖu_q40Ll>Wh6{68dX@"ﱊ{,_0:򲲏 ۺ$eK䷿Pi|*w'K`N" `GF|\"Klƶ%~ lyu|_KPUx<َHPD SԲ؇Χ/tҌQ?Ϗ WQ @A臽ίZ'˨w΢1_V'bp'RChQ-,ӻ3aX5,` zscgfuDH33#S&Y ӵŹ$j_S@m 14X \݃p0+> :ZVդ(j2~h]85 LMH>3|Bmi|Tx=ĴyB@x읡s0VxoxZ 0O"3Y|;%3FL3RD(7gkZ$J, ;i߳JPC`TnjEon˝ 0MWydxkt- (#9'jwzPΚUVd\%tnr$t"0IoCfP8- ?lΦ &cR34Uי;.EsiO(“+IxMQF+h%eU!B !mY!Y:Tlv,-c6JFMY*eWdWغf!rnl~{rJ #E.9f4${ҦsdvFp'rASֺ|L&7IA@$6@@[T\sUgaNji<3Eb*ǵ iLDNJ۬Jv.ׅp `E]<)SX3ر/ c! Se\gSRv3F!+ȹS,uηR-@v؆PXi -"jaO!i8lju1 \AihO3$L-lMс1QwWVguljX +9T?tnRȁ68dTC beCmUAw0`P 3}-53C) XtfN@W.L$OW<=#A ~9Ufw :*gC+bPj$'[}$hNl4M:v>5<(S3q2mksR=ؘ</UQR (B;HQhx~a퉃lAۺ\V["ile%d#.30Pj-e]'ape H.x96ZB*81fN 1f6vzgĤ^^0@L}kQԦx֚f4wa CJ]-.161Aca1~^$ #ӘD "G6(ǜF#ZhxΖRC̻SkG8|.x) i8@bcz /ƌ9@C _ȗ z4&5v\g4|ܘ3_ǞԒyڬХ[rYg܈`5RwT>~= fD)`!F׺rp*cJjӞ)\?ɻ?e5GŒD^BAW*PK:֜)C"APRG^Z~o HG J)y_h,L, ~p9X>e{A@E4"@`1 O$:(k(U].mG>]p>l>y X$g+pub ƽz#T[Lwd)qezVyߐp\P*ֽQ@O}mJf6 ȣc¶:`o/qٜ~K!8{5yE7 72g#BpQa,j  P͈^Rnxgi/Y0ZN xJaKb̤GP`(U v ZTC~dhT9ҏs,9AU"Vw҆Ay0L&f's׫'rc0Z"^!D\2@5 yBǖn hi˜9*qk>TIxk̅| 7 v)S{gn'Wץn Vfb-U#ZJ")Ю'c;LU[CE Gڦ$Vkl(/d9J_iX7:jhn׆W1Bz+֥b;i>A G K1= up2'e8L)4.Dj\DЧ4qzh.ݳRInd{kf'b5ずPe]A:,M @}p8X0JsnzSvqf: uW$&kP!?M5Kog铴-V%gڼb-H\(%ѬJl1( |,ɂ̰G1M)FQ( P*&@v[k_qRu 98r@E5NfE^:ZV!z9b!P2cHVb"eTf)vѽExҰ-xhcJJʨ'pqnmI,$Scd`@f eX.O)f֔#e4 ]kW GQ'O(8!()YX7'F Yݤ8;.,@vf.!0o% oD=tK0QvbX(Ts4occHU~2Ssk.NVAqYE\p/y>]褁¹Uy9٦pMX]%8$H@ zK@8&8a)|U| u#NAZ[m[}eWb"WMB~Rĉ$ɬ kƓJ%GR** X9#їuܫ ̍al+IAg~0[%I"nȐmVq\_fLH8ÝxL[y5,&w~$KrOv)>8B}a4f@0_:"֧{QcXR""" ".bP)UHOPcgTJ/B'p'^| Vx[%$?R88 b@P R1<xU7KtL@e9GBDwݞrޚU}8,h}<C.ZzyPD&VnyPdbYSYF&6Pp_G 0I ;+cfXiA!$A0ײTT\4R34VG׬~wya|N\$:jt(2.4m,Dva#Z-zݬK\Sd)eKq+ !ů2kSHA`F^!>㋏*a>-\Ը: e70Qχ4VcF S@4Yd"k= UBމ# z8k,PgJiɝikCL}_0"\F[ P5wٺ J=O#5pa>p$8{Y.}gi )]*8:Љu8* K^SsjagjϹock yNdmiTȻ2٫ -[Yn˜R~Xp)vѡ&w4@ژ]о}e&WebDB 3JQ'Z@Eĵc=&IzDq:= QpWOe0= \1pi3kxV}$]v@E>>r @ߛxD1/)@MJG?" ܤ2!_]G7_{:/i`Bh"B,ΏKSp_1X-I,x*!UzȯB7D/zbj(Fg(6 N 8yBa`r@>XoGF:"T]1\ ' ڌŀN+iz*]&sL(3dI&DI n "u[ڼ#P~Wkxa]hfq9 N_w.n^P%%<-bH%6l/8d3s+΂EmU.gJ [ 8INh($6_o@ɮAʻҞ E8Et7ck)gt K cJb(HIPZ&CTabZ\פLĉXOѾP_2(IzC01!H߈׬s9( ^ ˘s|#uFkuT"+20ejNfI霹)<]*@;s I_p*MDS.l.U4g6tmP6IE2 馄blS#d6UN#Mߴ`fX _%ЪC4$c@6FS:m5)U5lK HP6>}?TӖs~j\dBLwf߫T@ҰuU:d0<5->1uxnq:eXĔ!ġ\e?WJ|\]V@y]V<F㘞k37g?][tz牪&"hY PtNMd` K5 :hmzpS5zе 8S#qpֆqTs4 lAhM@ @Ԟu^wDHV"Py_^Zcqc"8 !ȕ'`砗:6Ǩ}uM:. \10U>{DEBIRۂoISNenV?Ьk(1TbAvW"&>qf][~F)H{3ÄslqѶ]U=r S:C*ӽ_tlG蕁W4Sa r|.j;s)Nf({R#mC Lvb$]:9>nܯHEEnjt HwGV̯DT>#*|2SXWJ)٩I i(; 'o lU{ڜYᓁ4uqU?:i㬖.=&H]dsbt0@0fV3cu@Bn4eIݷ٧6\k%`43*(l;:'ذ{, KsDx $ܓsg#mVパiK:߀lӄ#X;߂P]`eXirt(h<7t=obg[i;gwEp] G T0~@Fƭ$CA"rFI-N]'vA8.Wd1"_a3M;P.kpBhWrE {@h=xG_=FNV+͕-WtɓOKHz?=eOSmi0.G>y\zy: tW\LK V"rh@DH"$( .;:b3Uο(\xԕ>@Œ"◥ kD/)֢4D$jy!<9oy|m˭%g SP6 mepQsHءZf.͟;Pixu,Jey"vvNy/C gc3XI6,O= q5W![I|Y4#5ulR&ǑV[vB\ڊ(Ng(#[ԕD/ƓtV2fVT]ZG{\qqUK `2m.x[' D.+6D=p1xNPrev`k*PЎ!^ޘmICȔ2.^N=m *iz@8',!ry"|0 bbpb?wl}K'铛Լew b0U4a~k?Aiϻ -8[SEc*Ǝ>``Tpܝ"73EvU!f/mTR{ 3 8npm*0غՊwhpNbUGp҂6>_ÀAßQ㵷"N$[M@zCA+jW?wq7C|`Wbl&I׵/txнqm-~.=͜A "S;Z:V e#[$ڙ*l_OE' [OS,j)wdE0: T#ךpv5}'2=m+!Op==廚N<}qwz]7SjUw{cw۹/@ݎb2\άRf{ Gjέ [aX9n4!jpRoZ'qQ) z=KjbB+ O:Tz[}FZ5*oFD^6JfYhqTsK( 4smS̪>䄒bG7?pqUfeJD!{ G_z)qYT8zշǏߥlN3ubcXŌDŒs}v b|NN fY ]h0-+f4!'Wl>>ŜTn]˺4ŠF㵲17X@_]XM+P%s`<`$I-Kz_wJxɫ{}Pjq"fK~4[Q[ͼoj`|.a71?A& Lv0n؋ kG`t;Mua;Ơ7tn* i\W&j8^k h]S2U6C-,wWC2rf.i@ D[)& tg*j.$7rda.~`҆Z+8;YueYi@D}uBBٞ#=F]/p|QzL- (Zթt!ͥ fOzB< )#` S$n5V bխ0d #.Hݾ-d abAuwT\S~C7"bp9j 밽>|e OƎ,%os΍v\@ܷ>%{.R~eׁ,ܑzIn_@+3=rAB9Au,?rM]'C˻|0na) }ppA7NPL,ͷeUl ߿F d>1"z l!T}ABwm}?ؓކZֳؐ](]cAޭR'zR3qT=.ߏ/Dw ܝLHѢߓ0>4 ʥ1>VNs<훼:!Ϝ0e"HRNB_ziD6EŶBVQ0U]ߒJ1r|OɎH_SC(jw~-O9\4yPN.G CtvFR5&ERRfX:#LN 1Ɂ!&rʌ*fꎼj,6Er?g^c?9% s g"s,"w2ׯFRg쏊5`j035a﯏@BP,:qdQƭblktgc:P k\HDDD{jQpe_ !#iŹX-@vӧUP=<_tʭxnjZ[8m:UsKyGl<˓s__;Ŝ"i*V:֚8 ߯yfw1ǐҭ1ӈ!2dž40g!ܯ5E;?@GƮQ@xJ1 3ZsDa12+ClrwvͶ崅`koH9^% ypmN:YsVzcBu3c$D#,#r~5%\3k14rY.g`TI?8Q7Y Cr8ZMR\&/qkG_4N[==EPͬ){mMp-kl:U A؋~yWoSTQJǖ{e\jRKJmqZ^9Y:s@ ҦU<X 0-;"BƼ]}y<铚aI)&p7mP5)EN@9κSґ̏]ٶ~V*,FB1lmvX@ @X,ܿC(ߕ0͚PZ$Fhj$>_h%|5Rg><@t@2 8XTҐd~Br:˥Pnr A+s~zn\if{L\:H+ΪS7 {Ou|/ulH%c2XcD=>{8/,C qy(Q10ײx-+B'G=Ղz|Cu-<ю/ ϷRܷ$yLP #xŰsmmo^_N˺"- 9@YE2_v靵5=q 3S%;w7w'Mlѥ55zűBysgSG !Ql!hɻSGD eQ8-:JTQV -ٓBlS 4TɣFEi^N |G+kOzyIӑ~zxzXb oKhgxGo. '[jxmyǔtuwnqzF#7ۋttnxuֻ/VWS CkE %| F$UfV/-j{ֲᣣ㟛~z06P6x^_rɎ8J'}a6D1'y9.,:n!&kguri[O0A8ڰQڌmAZ5R/OL *s9=^TѸX%.>j{:Of"m!3ˠ$n9%h(=ιy2ƊHL:S c^FS4H<=ݳc8*GANU#ƕp7p;VB]p{.e3DHM,M~[ -R8[΃8C-p>Gmfz^wp˚D hOu|6{mOU}}ԼL;ӌ :E/o;5. XA@៓m1ϥH-H2BABE.fgЭf:֐7ru`jݨ4ΤJxx]P(0C; FRPI=ؼ-*}$rjp^Nsi@Sv/Q}wXWݒ4LL ^Vi05"\*88X]?QxBtu\`Mľnb0]p 3h@ {Sa0Me.ZDH@4dH'; j_5.+ "2chkyʃ6S~ <ZHC- d` Йxf{ L҆d+FL/}n@dEC9$7lo/f Ә?m` }INk%p,.(>Gs>$y~N+ȁ*J\{KčJV]J4㦺ݒJ$NVKLӗkc0R f:}חG$UȠCY挟ԻjtwFdǢpWVDUPb+J Ɗ U#}R -{s#1!Җ[gTQEʭH' r M @;I @L B@]+?Yt6Ŋt&s7Cë(}D"|VΉS(VY%(d̴/Q&&"I:lwe`A ,&D[&c)|wHi CeE1$=]o))C) ww_3u\-J)hYE!I öwh2J!I Y:p.-;{/k;wлyZĝR@ϛ|}Vv,el\@!H$$7 Ψv4:&^ <``L5㺼όpsbC<&0̹"iɂ7pLyͲ`71lIa-> ;S "VG_ŽUCT FziMŁ4V?ْ<1Z1] ;9[YNAw[dAL`zM="0m:-]C7Ӻ @~ NdUI:! pum'HI:~LL}ŪH{ @/njYr9դ dY$1$*BB,wl$kԜ^}i8<2ԱkJKC# MjL1ò-7*SH23gOc>~s69hu`t=[:Lhs7o|s73LYҷ/W.t.% O8uӜ.4}Cڀ^e'R!nY6irh!sBCr[ol@䶄7qSCf ŚlbΩM 'Oy`r&TBBY$!l:3nCAu9U7.EvN/5?#:&0`Ïtwp$+``IM9DР 0s/%8)jFHA$c08Y"uDЉkh\ *uf1[RxaMr`"`L,%S"x"On3k@ԍtÉw.aL` ŋ7mMͽ/dt́ӲycxxɝSVl 9^B $zf@;lſvgl.4u`:*ГLZzU+\Ap5< /yنn᫗Ymvduj::琟S[ؕ/tEVCbESʊu $&B8Mu7@oVقhQQ))ZX2??nev1I]!@IHL!nAll dx-^kg2F cš"x67kî& \vCq#.4sE=)KCQvw[=|Ub8xQX{ק=BwI./a.0VL%ϋ:j5ƀxLQXӢ|VwHqtPn:%fj[|֫(Ŀv3̙-WT2l3Cҁ@ 3bGn b`f볍,8v-D x;O:/ ,R2妲B>P~$'ng=}`ڽ#LE˒Z>M$XPo/̿x~@ $䐐>g```r$Xj!ChB@'@XM۲uHB@Dź_K{rɧ0#ر_$?O9ň`VIZhm_4ƛ劭e6yoxW+AvA$>WުyAv yūuz$;9wP8f( K02p+ PO  0jѤ!8$ HOd;TVkхj(ț!a(/&@M9̀\7@t㰒C7dةjH BmP}.TxI._E+1;6KiӘaC}; ?cB@&HbdCy13*j'a[ā'0l_WW_54U1!\&U$!^ `B{@4|$6@<$>4[ӿcy[\ y\o~6!˘pb4\\f$ k q[BrؐH3:TI6hO>CMPirX X@%QsmH1PM*:vS6:}8 cz͏'>Rk7Dx6Cy,3 F_zŊ`BI$l&&VWw>Bi2B bBɄEZOˡ>Շ@}(%Ž`B>/5#q8{ݡa]q[X`IONGj$'2opT<$HI8z.ހz\T걤%H %F@ .2{ J@  >l`m w^B i|=sm| !@awE䓐d^>~]A_Þ?!>SlUŔ7p>gB|}D@.\˚S)Ė `d'`Ä t؆Zv?sƎf=%0'H1ɗ+D?$Cf@~,ro;#߲b~EǸ\弜;/o-]u;ٔ`&pVePK&4sWC(~༓f-|V]D`~cR`J9\K1BJfNO"`R0ʇq8ܵ`'!" q@Cv{is42VM ! t-@mqtFкQ3 @H LB0?O5Ω!'.#*4!D-\X6/8=c>3"F Q1VgZkyL G}1a*q-_6j:lӛO_W=۾/ie>PGݏ{66)Yء9_bf.hv;5׽Ft&ߵ[g3X_N}Gst?Kw.>nGYEiRf v}sNǯMF67 zsU[G~Y>gܛsӎ4O~ct:6C+,=mM8_jy84 k:M&Hy_G۪IɏIubp{;o*˭sj">LOm|w|W3} ؟wz#%oߡW,j/F6B*@IѲ f!!в@ 3 @CYI2h$ ܰ$ C!$!I> i2fBzIRHc!OߠMTSYBHS!& n]J9f0$=j@!HI$!!$4oRMI$$ 'a! M?$e et]E]8TpM[uOM&0Z֚DkC&mX;X!2b(*t͆DQHҴ*r$Yl4S$=&"C9 UI٤6Lrܣ ÕgA3фM$'$&$ yPX@ڳvg! @7 ڠCiʨ@\m!Iq$ݠHMh&Z8!BaoP C3ZMH`HHCrH>ZEIR@P7,aS4 i)*%CgcP}|jٻIOQDY1&p?ɤ֦!єCᆙ՝x!NuURa|jcC3 H)hLuhzYW"UzwcdYFEE9V T=Cj"bUHQeiR'id5 i&D @iM_ШCnZ0 ,96[=rB~N64ud X"`Jd@i$ n2Nn{vD*",Q@ !@@$?u}$~&@I$!vFIYNM$H!$$ ` ! t!!6Ig m& ,Ea\Ru y+IDNku9aU;aQ܆@AI BI #YZN~.sP0 'yH`fg2t[= n/x-/aH#2Rw=` # 4Ą76X:]z'8Gqvb b9@:1 Y '?iְz7N̒p*K*!'#ĠJ@SB &8Bز H&rI'RQ V$9@.Hqݣ:BCa`G= zZئEg`\ad8}%M@p !}L[&FHLKcd&7(vcR@l-8sjAdY gm$2lp4;3IR 3Ha`BM`'޲$$H@[7Bh1`qa٠SP ADATU]0n CI$7L,$8l;!pmgiT E\u K}T:i4V|,7a#*?HCr00 lXUwnms@*|MT:4Ug,f;%N^˥ÓC=mN醫 uܳr6 k\hoaj6hN5%2`9Mq痲)> !3rPBm$h㤐!˷+WB$A$:vBI#L$HoI&$Nj$+I (a?taRr rqYo97nmmnհN:M4 EbQ6tm]o0]aC ڄw)ǖa LY$D U-I 0XNmcf2HBCO؁$ݽI3Vҡa j*cBxI9d8z@S $< IEMY$$բnXNG}uQ5:::~mIgJEg~#ssPx=Gm Ret#3 R;KY$X4`闇::Y;n;'6ew]]++t}XI( Jdq[bWvڦplEh]sfBbOS[,XO )*EbHi8[I( '^sYo$3Y2 I6MK.I$!% P¸,簐ɭiyh@2.oi3RgXi2I!{|25'!~}6|p2T> l`'D_Y 2z)b,mjNz>dY68JYybS]H zfH 'q/׺whժ.BHk$$ 8;J$: pvtlCx@D& 0 B Bnj 4OwU<(ȇPW0iڞȌR@2Sͪ"0aZ|n '0m19y'H UX(,<) 6$YVA`(EE/dzf&΀!!̄$Lqsm Q¨च1QxhmL%2WFk$;6IaƆ&h9IŁ K7Β7SȪ!Q`nb@cvVH4};]em6LmxT@추B$! *ѐBf Hf&v!3Ygo=BpВL:4BY9[CA6|,g j$S_ՔCw۹{UϣKZ(uj~$DBVo__T\ ;CB7%ݸcѣQ~;ୡ'AG1 ȣ2яIjzufUv:lua$4]f",)Vߧ$wYМG C÷L!!ѲI_:,`s" vӢvERY4HM7[$fRnXY5СӧN4szM;E!:D*YaLHXsu&nGo70nk_uѿMDD6cg2j;&@):¸;M;t ݡQ$89i 8 _tBMdIѤ6Bj2HM Đ=N-GKAbE$HK0Twci3]㱩niX,"TH RH(hAHeNBNˠkq.2@PY$ClTo.:!ӣP$r FL ŪȤ%b0T`gO\$ F$5a[F́l΁EGѵX"R)AKSx;:7dP=!aғWbyvGd u=5q1)]4Fte>c i7TP)aeJDZBZ jmL&kb"]bFDDn-]ͦ特Ógbj47ZHAb*@X ,:ĐdbH빖+tjpft8v7}h$XB(((E)`#"P$Ҩ# AD`*E83F cҠaxL!$g؄I΢g9'xnq C#KbCf1Rr x0ج97&AF,ٛ5~vj0&vo˳eD'58i+R$@$fÖ I kD6_t4S{Ġ[V~ҸsF3:!.G(quԍD@H+kc&.VIls09&o4'QCO~9aֳW@F!Z.؅ٽg!LhX jMMimvU ljuMqcqss(!W"\1Ӛs&5[QtSO$j :}NF4gKP6 7&淤*ۻ)& ,.M**DS4n|\kU طpfˬzTpv\`xupyJh>PC>mdL%Cldᆘ{^(,I%vtud/32kt8f*"30D5eR[y5(O|J'(E$GAUNZ663nT<8+h Huw+kL'B$'@9E !fIwS@g|In:I::fLm]MO%)z:WwY5wwAig=8=eLkl6 fCU@@&!&ѠnNIUdm]=g0޻0z;F9"1Uv>*g1_owR @ND`1;?@C,7L)$ku:B!0`Φ5@8|a44Ư"4<o !JW?7h~ki]j$g Hmtm35}"(``m2${C~vk1ܙo! ژ1씁 l}CKLe1ff}Wa`%(Q[lQbV"Q5kj-Z؅R*6ʬ*BX` \CHh|ms󌭞@tk{?HBfJ~ 2TNC b`6XDͪF].WŦz- cdEw5R 9i#j LJJ~l .`gs46M㯫ZD!a Ӟ\ +悧iC@m.0m D@Ż}f !Π:h2pX3aȘ  >ԍ.Ise;eE1uZ\_1.G)iph;x{ӛu+GkPmX'`C`NِԺ\1u5$MmA\xv&,ÅO}, _(qfNo~ƖZ6noIV[T>ɐ'B}.˺Bn}#o}C@cMӘa-Q\o@=!>"N:7]N }I6]7ut]RY8}ρFuHS nPN<<%飼[Qr= IHGDrR@X$P!'@P$~ \Z ɷ(3~Ւ&d"; DHwȜE3ؑN+:b*ǕkD.=hfvF.:髥u\]ݝp3y5H<'kb"a{@0fCp ,[Pg%*ԩtCB4jO]Isϩ8ΛMOROP4Xv<A\:)m]2Z侫 WŁ̤z+iea퇫pX)Z9sX0 (# @@ c-Fq3 m 䖝H00P RSwG5kJ53ex/8ͣbeY)64kجpn{$6MQv3+32%NfmxM]Mn[bӷ`pd s4nV+ R9.Uw D` m\jh07F)vHpϏ@dd^Gݬ,!9MX|R!˜9%~jhl63SZn>.~sQϰdN1KO/VmGJ0qX@6rc@.'搜&* :"syWºV+:޳I۷a0[k&4֑p s``bGA-lp^x:pCGxH FTr"Zf(t̼f6e9_YbD/d(:zp$}oBC1 ۖ˃B$!!{nhtjU|pqmo;PHsS2$G@ 6ld6s-ZXBD*wunX`LJo9eӂ Zhú]X3S:Ahih :-|@BAdSl KՊ3fýxLV9&(qrjnN5eR>ndwZhզ]A3^Y6/g Ɩ8Rgn6-`x͎6f=39 yu-DUYD"-ώSE ^:+PO K^I#Lo.(ggHH[pN bSE>:hP]gÞZwfR5G6haL]pnQ~ T+Pu a!p5^ՒuøyÎT4YȘkɷ;jB45| k/,gu~uiI<ѬkDȈ̀}3Cjk H!X1 zʅ)59GܶxT|q&8"`FN8(rp23,{9/&mѵtQgVHbvC#D@.FF8“?s*l9J*܆͌B ` [@Er0- ;ќ ")F@ [D*NWj.$s>V NdA}*bailjAjVңRúڒ2ԭ[Ѩ)Y>{oҞi@I%;" } hyY޴}{~p[ka{D6j ֐P\nĠo;VbT-jCO?c"@̎sN%l۸A@`5u%մ9R#[ Eo-3) 5+z"NTf& NUbN*4;w0(7O%KW21D`̍ړedJaf ö{RM>hW c^dR>pq4282+?%ݷARwe|W`a@%ԕb-؝~5k=s /[ghQBN,n(zS]q\ J5ɱAk+3eП┑I8, Nѓ , c@`x"Ļ5,I zM|:Λw,$x3|DB`Vom&Ͽ4iXjq#ka4+p6Ɍf/+FE`L@,@ke;D8~ 4cG oX$ ׻-: iێ ;M|]8zbñG{`%/@kC @s[VSz8w}ʖYǪK69ީy[C 4|26&^37T >*C8 E&5 g%LT#DcLc`휅-+T/j]4Q*Puy'! $ʡZ^K`H0wO:Fo__M] ;:F` }@ Ph*?%PjkրpEد!xVZ LGcSm;zU/oI9Xsq];Wq[_O{0㭥fyxk]{6Q d~#<|tt-:WY絝ݔ V3Ǵ<_b2W[kg:q{+{W뷗L?ȆfS<LЁ[yCr>^m. ĩwt,2lOikBOU<`UP~=Ü&wowv/%o5W%zs&q \{h]Y\E ̛~Ns_}HgF'Y q_10X3w1nJ_cSyMo-U xcl/{di1~'tuvG%iӻ{_묋"l~}o6VMOVf3?'qrV~etO#Uv ߉MR5}.vc&g{ 3]VDer;75Vj|cZW2jӅhvNG1Z,mJhc !!S\ @)rH~ɒBBHB`y>8h@6r>D(Yh(.4D @It$$)$IEWcJQB4D*2հ+)[KiF5(`ʡXU+V*VЪURQ+m +heZ-*-T-Ul*2E+UQ-ZZYm-K[X ij[lmiJĭUT(,Jb lPV+ KYVQ)V4RZ-Be¶%"V*[IU*ڂ(T[mQإA)jR,Zh¥B)Je\+VmmXV֑m5F RhRkDVUamR+,VV-ll4PYZ+ TkVeFjV+cUXYE-FҖ2mBY%$6n$L!dp ip$$f$5ۼO셈@QBBBHɆI!$!/HB~$$˱^$n$ yCj&ղ,/BI!ПY-@ fI&"q @̨hn̾H@:f Ml $$9,!&8!@ƀl?,%k >JlDQF$F6MВ\V}Iv PeB_ pP "$ ,IS yLC%pɭkWEOSE+ pB6ŖTt'y}3˕b dHM$YH@w $&c BM&db?0$EڗMdH0 $I!Bc@1 Y&Rʄ^@E ܐ4h4+ͯHL18.KB)Zim*avI2M5 MbUۗnTQKj,`bIIЌzoV-YSO麡lIo/qI4H,$!&rB,I41R;~>BnY$I?K$$P 2IԠ 4BB;5c យunVTCWbKH3S5iZ(wJkER&\t+9 zBHBICg nX>W6կ{^ݲLa$}{fCdh1/T$ 3cB I{簀rHC=$LVId64:E}X ~yg JХQVAHTI(ON /mnc2dJp)ajpK_z1xyUqht+h\8`d@ ӈº˸]%aj (bߺo&^ 4YB1E6`@A $-N2@ `}>PT@$؅ΌH]Hw&$$Ȑ 4В~s$ $05A@몂I!86y $HOHOk+\dd0SjoeHI2!I' +.ƴ3l˚nL!.ZIMg"0Bziwf8̰jZ%`p,I $I2& Zҫ6(rCa;fI$9l&W Pi@0!vCNic=4@Hr3-cm/i J˸ٚ֗J%]qwm ^(xލ0' >) `=vCDgRlWI! y6w=ܥZP[C$@"ZHYJcUH'!DTItt E$@ $D oXP2ved<$'5CM4$; C} 9,r10~[I iUs*C`P $XzO%7ovH+@V@LWyE;\HᑢPi2)2V;Yr !}o:4 snwk cZpfXT;:'KC{T! K^YIBs h]>7^LD:'HHaBHwHBCKRBB+j3>}%a}*NӶcR1׺"ER nYR(37VQbb%T}gF]2Ydei/o֑K BjgPwDfG:Ҁ,U1MD!ղa%+a)/~/,̳ofئ L8Xly.@ ;ЁGZ㚪FA+wvB0iQ Q7R) 4Ŗ/GI ;c$d$K[!N3d3XI'$N;igֹ[3d&CX L$jl4\5RY< !dHэhs.>$R@s( 70z,zk聞zXNRz_2m)ł;$PC Sx o6bÅ1 j6h6}BVc8aclK7F2B=xDXC1iBI؀c8gd'PLuװh3>7=B}FS?I`r$;f@C5 tiyԸͽd 'bo*dJ[Un`AJf8x6;eLtq%T(yzO`$'IRfՎ$Sr<*khLمY _Xg}T&d%5"l,)2¥ (oyGM$+XXC$1!4O"ON $@}R6P&!jnfHԖtWzwNax<8 劚2Ԡ8D``NBӮd$jw5-F YT'H LI4ПCY!ۡPmXXS :۴ln{,<͇*ѝ xTRMg\c]۴ c6$T*^*Ұd#2&jXvk6muHFB|t IŐ][:=sz8M/hIgH y>s8 0 HdI-GU}mdyu=ֻ͝qIqt x!fd4a,$통*;wx]-t3)z'_'9?pWdr[IkK%`BHԁa峆 44eTg#KHl>nitQR`s:ٮl3z 6\C+eM @0ݚvcJ^tBZgf،ݖfHt?D:ylv;vuBoQ&p͋r[[0pޥ͛HD&i4BtkH]*V*qyI9-c`IC*u\1j,Sƺ. m8|++ <CzVo2r0lͮ$3uIkl:2{{xu᫨1] urWOD!aCELIJY 'f{mљSZ,74z5ox6f_-NdtH 'n VAdHoU$66$C Ea:m@2d)$>u$ aFDM *Rb*X-$R}+-ID+Ұ]iI(ByCpͷd'$d66oIΩ($&% % o5XҨR :āFC뙷H|?sc>F0o3S|f44JP0cFGZ=QȌ\@f̉mA$* 9S0`"ZtdRAMI!sqwКf@ 2&d:2)fbbÖ!ǹlX}I'_j22c fLM'bg^uԄ+e;%g(R :2]"TR-˥0!&rhb!JSb&ԝL;6M1$P߸sS0Btd$!;i(^Zl4FL7g&DY4jdֳ0s ]d7duavsaI ^ЂId!&aGUgް,3[=tꐐ˜rpm1!ЎѸgyF3!eTݯMH- $m~\ )ѷ}[-2S!0> HfOt<.C6WJ˳Ҵ…hj =2I04_Im.Ӹ[Hn7̑dDҠ6c:vT A7hz/Ԛ1dVTxmkW J^/i¡clL= *E Zj-&vNq 6i 2STB ePנb, SS]Tjd& Xx_U)Vʚ  E!Ѱ M:L5B |7'hM1 ~־{ة{Bui٠vi$8[3rgg]u:dШnkmQ(Ii DRBԩ$r>Ekm{(IJ{Ii!f[en< Ql)3Kl!X9 S Bba;d%"#$'cZl"&[r׈ qe6W:udipsR0Hs@ozfNYRO2sɱ1WH !ڄVj2r  aB ,Ltk$Լ4LkPkRM~exj&fua`!am&&$ ui Sc*" ,E_" P $@Y<5's¦=)ԸTwiMq-؂JCuoŸ&hb@ʴ\fME'DIU%+316βN vj'.i!ŬiN !}B}]ob~[=owuP Ď ;l(WGَ4SY+:BY|swUώ9#So Ga$\n umS.T^od)\ |O7ٴsVfrfڙ}rmQ}9g͵Up 4অ}ַ~oσGs1`_'px?scT쩧z3_ CJ +IY}ȟm[ܺ4wC7kgZo_n;c抷"}mxxRYI!$ ߩ4bV9OR~ŗ6T ZGy:}}9d'U"tJ+OHڪ͘VH{U]z4;;|GZGn ra@_F~מ?}_8N1 ΰ8mH Q[a{~{{6+?p;—oL[`(vgq{Ga>BV̬ IHcR8's63je/ޯߒ.磛[tLzow;gqJ6ĉ^q>rv\lϹxtͭޒa+7Mfn ]ߗ 9ouo՚qC9ei>=+ujx})e߾͉ɥɞ۟95%[=ohmBBb:t 3r%txx_6 t/NbOƺAỎ.[ ˿u6iI}zJE?c}:?-&9N2pͼ; " ;sKW?U֥gTB{vRw 9[N1i+dy*]Cc&ߚr? -^NARة#؅mX_bZl/o9 7US]0G}( [ >@jASDbF<_[c5liN ̜Ɏ!XR`KU4J~A9,ҙs^IU1 0`DʪK̒.#_h\?Ď + .sRfH]vsI1v3T^a;Ue\!%Qj5^3l{?iR]VA1Q7Y4pHIĶ7S{[=TYDa|1'3mRL"I\s 5<?~eXdcyoYn99`-%'k\rw5'wuztyv+A{@ !Ꮖzw/5Ǘ]lЩ?T+ӳ aϯΰ$1Saµ@S;9bhÉ]^PIK]&~nr::o93.}icEs_YhN>;]bq&h_"b{{fd^no0MkeӮZw(gwphZwW\KǞco,sT'U Y&;ՁsVOu?ȃ;J*&rzAiO@>+cc;GÕխ67a1~_4RAv: , A:up\l.جSL*}+bMI1Wyee _]Rl{ee ɪ͡K E'(> ϺsYYNr]u#X#7 đi ' rB%+̍6֜pRJ eST%G)ѥX獵{YW꿹gkhTa"B?+ )?| Q4ft s9w`N ]b8S\T`X@8[ǑPoɊ#g=CdERʅn]D˞E4-Ybkٍ錮N i'u#Wz,s7?m`#ϸKNŒ #G e6Kk=~Bv6Nh)ɘ@TD'eݸòԄ&a2uLCrY;>D*<@}1j`E'` \BX&=__.Akd}h)Oa/ty^t4PzwTV*AÚі 7363kyӱ>-׌egL{̝ʑ=s1o-iͫp(2vƬڦXBWj(v^'rxw!n֕~݌Zz(S{iLUoV0IZNN'Akfc-#Wh1߻?3#l+\~?ǂvF&ogڧ w~Vq sqM$_~PIpD -Y\ln5n_ >kpB|Sflq6yؖp >sn㝏C9=OT~g?{|n.2YW}!dcy3UKAqTaOŮǔ (P0% ӬBQVY.2E9sG3L v>xp()Jd0k\. $Fwy~ pMҸɺ#7R_?k\R_U8S.sGyww^ƹ׭Ma p)E^{u.q-)5!Q~ NЎ%ITieLO,GΎMd}/9 @3  PF;Sk~$ې1{d|[ڎenXAITB/ բP)[,@Irt/;۪"4^xHo>DhiCB m%ݯrG:^,35qYO6-Jd~C|j*h=mz~«B L`W \ߪ{sM* i7{>sz|$Mh8yEv42ʀKPQ;((zPT.ck՟`BS $"xco=CTwkawwXqa7DvpyK ym{..bGu鸾)?='!dVA9Z_HĚfI]`1{'3MOk{]?Ł %" h+YpkNu HwXxU#^}⚖.^bſ%j @"FLȼt%ZUe?H<@u([Bkݾf`wLadd;h( jy@686ܽfGW[x^.;xӶ&?LHBd5H„TS׍#\x z_W=s^}3s⧈>γ)} \.j;ddYlxK(w:{mIH]zJbE2PxOnK6^K%99I._8i{P"|\(nh-r/3k^z`ݣ]{eNHoHUUBAYH2S}dEG+޷>eqX a~%7cQ!|Ejà~y\\Ľ'Yp x joxi|,cPG| 嘨mǎNN5kY@[T) s(`|x LODZeTYѷk]]3d 3πā8<&]1q8)c_~ %e oO~E#Avf[#'׋넃&gq6)c&]3{s>a]h82nyTf\'J ҭEMb4n7D#.j5Fū5dba0 J9ffӦOoEIMYSYVe:/z ncP~vPsɽܙXt[IdEAu V !cK^pT f&ƲOP:e aqg! +9R Ikk v@<#9g+Ɠɨ T)447i2QKi%EJuěu=D iV2?* 7OHQվoBU|zNv:|/BGi"w)L!C}!*^)0& \$V[) P\`[k)" E1%8(7 uP] \{ysӷa#J{FIoeÚΰW_Cqӆ 2VK~X}>f_{{wslϦA>:ɒع-:~[Q>K͜|=vp)@ADSZaLJ" hoN]+q+@+ڄRճv~-&[Z|̙nƸ7xys,{uU5ia-|m1Q1* )N`Ja-g:DA1SNjɣcN%X9(7+)^ gw(_=|4yAXxXuu 8 N6) a3άnHVe]M\=vVΣiW.Y!)A8P fv%-deHLƸ'$E_<~|ylɍ^ԝu||Uuk1}5͋o|op/[|{(jE|4q6wYFnۮ΂eUhWJk$#Rs:ܴ7xŪۿ+[YF"s._ق0@$e Ҧ|΢4íCmSm\5pOQUgSjhPRnnIU;71lj2`+Wn g.Up7W&-}R$%ܦQ(sjd&e^e#ZțgR]Gk؋Od iȣ670k%'p+ɶXTs.VsBk$ާZF&-&UxUc}+]):cgN/pg$&٪q:(AKn)7(yC+l?)}Dž kjSi|d q m/MGXxGԵy2l2-F(3)斝󗳟EX0f9Z N߀)I@6ZGveoGp'y >:0{iJe X,1yXXw[nTCp=ݽCdM4|r O/CA_麮7:tXJ> \N<̠1﹩S+H*/:I&#N:=;vQEPYo8YN$*J=IQ`@L&k.*T0X\O?Y`q-`6LWsjLR2 &8DJyQz֝B[%lzWn Ǹל%S7朏৥rOGc gJw۵nq=\űM|(.7,hୟ',1WeP//_ra||٪Uj(,Oj &z+}(C* Iqqj:v|0g֨mdfPcǤ؇{v6<7:gmau* q$@ cB#5RH)C#F}Tq?눾48?$ꂳ2*lc9DNh/RߕMݦ'V>V;>9@4Q0lJG=UE}3XIP,_4s?Ebcrfώ~Mkɉj8}fxq $v&Tg1U+cV]+Y |0ŧ֊%ܯpoYYVs)#.;X HkݗJXnI>yC{Qb\Su]䄻)||"'oOU_- 'R~焨H@j8P&^Xu'<˝nWC=kcn7L9u/k8E42vl kn?@ g%U`Eoa|Oz4M8=ݵ !Mjo7>^., i} &D n ) b+rԷ2Je.QCr Xnp262]u_|z[~AY8-ŐJP༼60@he  .d:O&1m0z"K OYĿK e2;O3[e &1cn\tq ?7iceͿ%oM 3NJz*|,LZ;|WH03D.6Ȁ 87֩+uRD x`k ?uڑYVf` q.,l`gf41^,;D< Wnfg Aϵ `,&AbDjGx7ʐu{7BX6iy2nb__FɮcĥmWГ%%[ĘGN$ SUKI~Z34Z-% G:" "vŒa+ȕJk!_[;=7(s 6!4i 2\N0fڽ~bsY_ {Z5<:g9>o:*A7䚖^WJ0^4;ggOѼM?uG`dϫݰQmKѲy/9ZS?K^n֪ՖC]_ӗgx/hylٌJ}FC:KoE婗Nǽ+s g,Sm'x,\Qܝ{[C7dbzz[7\pEgip{*{\^۩9EG:CJw;h?o:3Pr3]?3%{hlQ0v-$6ғރbJm+p6l;[oһ;>7tX1ҷ3C#ot?jcJ롸Owj1!?**Cu>SI?m9XsS^ g@^` n9袮wˮ>+wr^./јCTY|xL{^+V=)Ӧ=gǞ]1wt.ac{\٧Nѵ>i]=߫M"2:,W;?~JpMqn<цe2W $>騋9!Tp4_h+u0y^G~nogݺ_Ԍlw K~[{'1w2 4_>[ {p'_ 1ӾO/WؾMW;̜x_]&ۻD ܌ P1n82ݧFt ) x/3wGHew9nZ%,6|&rs nPX?rs6O*Q`hZݶ&RIGm/d8al4YMÎ܊̒Υ46 ,>+!a?~ ᤇ4AJN* zOSI >^YU}yb}Vn:k!!:CYHCnҲC`nޔ dvH@7KXĄ$`w }OHym0\JzC9;d0H!BBj :dRI ed) D $D H}BOd Ȱk# 'It H@Wr;+?]!Hg!$ q]t $ C#?ÏRHJ O@>ڤ@;6l0fuH`d3<*$ f{$ 4\I (pВ\O=6;DVUh|}b $!^I `f!$4$%Iܲ@ 2BIi9 3#@ ,㺸$TՆ6@"!ZM45 9"? Ұ!`Caв`;f<ĀC| 6lMHMBq$ %C`@dd"1$ l@'٤2wHo6z,~@3XH B$e[P,BM6Hqf#R֯WD/i hVv6 ` N*.ųfy7WB!KYd#r<{Zj'jK?FGǛu4Qd?8~/oj;+n$ ea~V~d{TنOnͿIh;ul,v$](T>flֺ6 11MöۦCz{6<3hG#PuBˍ}ǟ5ct߷}_6v#u99y T鏑<.gnH .8gez[C/@MAZ/wx_" eY V~,SUFOޯ8aT/F(&]F֝O.*ͥkG|>_qi#YW#}NhO}T~.-hoJJR|mk=mL"M}gDe{q=TN4p-֩dzr?xwsB'nS[DqҘ{f5O0EﭑA0I~mŷfY62 %z"& ΧI%,kR=AaFmK$"{,23j|~mr*ᝎlOjl5 jקڳ2bφZo(Xo6` }ʡZ2FJ=>Q650 \r86o@?)<9R)k1gf+}MT Nen*}\R[E+~KBJcclc̾NsvrԺen+~>6S@EhQD\)q"t#5≱J[.MZ7trA~Z^.z{@CCR3O;*S{-t]0 g`Vcb]J& T9s.̸Jf`z8? ֏5e;z^і>^g4Ӳ׭_\;ӸptO2Mˁ 4mfc6//n55*~gz!X '/3N ^VTՖ\^H N~Ԧr jF#|Bp LOGZ>KUd7bے`&Xҍ^EP:w?v (B2UԂrtd)g$xH U{g +`Yb%etIPU;.U/`RR6b;C+NbJZtrل0R<;Zg&rJQ}KmuH F"~yS~͡hX4\1~ʦIe:ZlvRωƫ;E4+Ԣ) |ukka"Y{.tMe ҝǵ_|=J`'ݥg'8'5|OVvdoNs~]A8>e=Lg 7$5} EZ0 Cleo}&>2I{IۢI:;⤇Ol$`NV7 @HY!,}DI$v)!{pIA *$$?-6$=K2%$!۠XzdHi2@9@lU 'amLԒlB$$0 S$ TOVd$ F@1$2Od$jOaBca! $!!) HO@$!HO @HH!$aNc :F@!Bfue!I I~  $ MF \쐄afBNQI&OI0'I$€Rw$0$v  @Pp`BHqBNs!'=$\&0I0!$,B@a>mR @2 w̐C!ڧ gmoOtL'Ok҈^ kӺte^{6tĆ^&ۯn== 2b hwV?9Җ+xmS!aޜlƣO}Po6sM,~ >q®E墼NJi7<>-c4,Z}v̡9=cT`.n7wS÷K{gIg,^}ǸV WafL%Lf6AN wcVݎ]\V_Y{kF՚=z~{W?;h1>h3f^c ~-ds=P)wWjM+BxzF h3J 4bC:8QH …V M&~q{ -b+La$gЛщ$> X #t'ɯ9* *5v`ߪ $O~~^5Z~TuEEW^Aoa'8"^:u# h)8 ayzbq0yK-U::v "zYUlfA'tᕸ\ 8م[ G~SN*Z)hwS_Kz̦sPrs7ퟟp+ ox&y:sղ[-BMd5W铛qټ ԧ/ݼ:g{;۠a@%`ſxkU2fdwẊ  6~~R^I:6젒d=I'`B@@7O@`I$d@hB{ gLO4:v`O2Hkca|Rl@$3I$'@!:|{ƠP?iZh#$ OI}D9 ',`L }ՄId{ }n˙5XJaRB B, ca #$ ҲOH@9HC~{$$ x$BO- =Sa cBI2ЇprHBP ݰΛP0 d Bvlfٲ S >?[ BDz2̒m i2 @>@3! u oY4Y!L ę!6["0ߪಟ?Y&gs|El ;XՕU,y:tFn+}Ae[ IkxؽT9*zFh]^t}sh̝|p[ѮWKZ{eˠ"ȯcp=Ghx'7Z\65GRLXShV~zcf7K4ۻǩY'HwZGƿ9:iޠSH#ϠIݱNtr uK3 !S$S @q%+sċ?朇aq2wJ$G62횂K^}gcIuh͍I$5v-"qZ)sZ`EOxFf$v=@ ;-aP;#RXQ  W%binȂqI0T{0=g|h .8JFU44?&Sk$?BR6|3sK̳0)4R0P[t S}f}٣."HRfзlC-MlEC\rNsqwzqnm#O DL_@ xBBc6EvNJcVPMSO"h#G$!9-|Z׳v\K{JTӚYjBle& >9^1|x=X?7Zk(itjR Yq#@rvT>aw(o*mܹOd\򮗙}4||;!:0=ۄ֎ yl}ӂ e#`zՙUth~ &]I_0!pǬ@g@*{#*Mx߼x;يsYnZ> =n+9; qBYANEi4jDx" Bb I:OvmQZ!a)Td ;/Z4yyL+MaQw| :Yoպ>/Ke|~̇bJQo9Ͻ KMdq1_Xq;nײb6yM,!&f_1IcVok ;` vF0 =$2ӇGbX9?Xf[dck4Uu>ncw$X1.S>RtN֬)B(3>7[|6p?l1#3> g%fk#.8ntjy5'xڦF^!:Ļa:V_S1= x CoJhxg+@HN’Ґ~;_oAhٛLV>Bo %;b?ǎYIeZx[([<F!<0 !06A(98NN8~5 HRٺ m_O(9IwjEA( ^O%qp/'Ӽ6Ev l$Ŗ|c,C GV})-h kr=!Ju4{ v;+uHL~F/_T;OmmtWgP(}7EJB*9IkO'^Cyzkv^uc6:IXuNkZI>*:UZ;Cʚ:U.5ۋ W(bhhO:ݐXdZ^eǶVUJKLk$E5 2ڈL2ӥ*Y~1x[Q@zP%Owjp6*BkAEOuz J^Õ;3I_S qogjiMSLXA@K{Nd-1gLFŒAƝԳT'Tdk"{Ć%gR²G}DfJLaåtǫ DpUJ4`w>V=YyB/cm*)Սc1%J RP+"ȤN=4Ciz4 dU XEd).rT lY 8{gRmr1' ~e: Ϟy߹'Dà7fr2l!ʈCt+Zo+[w ,f%4psњ7nu%ffN?*f'8z2w "zBsBSӐ.g y:ooO]onzɤ|e~Gyg{+CkB{0 d6z\91НBa컋O,|R[^HuN2@2 N1ww@VM+@=31|?X!׿A eh9}5X@gMI|u umo1}ٷWHfI!AOX@D {ǝ/I#OpwdDV;y;~ 7ZAfG<aa}7=$t}*$p8Ej"00/Nl1HtrI!v x6!(ƴZhLєʔͲf^RT̆TUTebRA 0DS}QpE G9LGTdi(a4f<ֆ"2g U<LB`_!Ht?n^Ҕz~ 8ؓsAZLO= ^xG$5!H#YDf//E7X:`Aqk8GoޡѦ[e &vOc[ `85>֏FB#'ziB3_Kqe6&qdi^kœ蔵s˱ϦB3Ju#a x& wPp_^*$Gy.6Mf'1\{C#G:K>x_,ڐ+ѰB\u%#Ă,aYcf!'M`І+:)viA%n?Js>y4 G`I 9RͿ[X-<(ɑ5 %; \6 Q$%w.o,屳cQJVw@0`&4 _>DYթ=jgGAɅ-<^LeBJ }oِD~`O=I~H%a}fN:좜Zi-D|¼0x8H W՘uxACq.ݔ'J#AxuǜR$ 4  !b'+Ci0CZ=v_pb--w?p&LزaA~8*s=\x0gHt~7v&,kts$dXE?C+YcpL{i6Iv_2W2  ,csá_b/vs-0!Gɰb#<gh?_{ep'a Ѱ.dS@ 6/ZC .MuTQoT {:2 u)Bh9;cCcmiQǎ泈\1 d hWHO$5u?i!CiR6'0{:v@.ҫؐ<EN•|=pBcaCiԓн!LЙLk |&H`H>@;G#HöKԒIINp$ݰOas5,IxQ@po#g3á~Vni(yY=k'Ϳ.2uMvJ,فɸOJPbKE~x.ʷg!qj Դ/pc}ÄQ|ky^X9xn$ VדgPг~w:- qrI~^`V2Nq c'>T3r,`)i?6c8wN _GM}eGzE>> ` Xrl_H~ ;ѫKV徟5M]νm^v%kOV#lMslPac% UM "6zm`V!FgDy-w"v$]2BِfѼR/W?fzLv)3ڿ}G\nvQ1Z)A=kG[;|P:̟w|=خEQ%=@㰲ys]>IN=G-HuEPoY2zED̈́: $ b"I6BO@vt=}z;OH@*zed!0C'\B=S B9Q$=Hܧd deIϠnI_gP?wR І Õ$bBJ@TR .)jMKCKmHILpst@8|?'ƺvI3koI`1OoT}S)4}}!g}&?Q;/{ƛm3Qlk;^BwxIkjl60/476b|/ Ĕ;LgX $bO(EU26cjs -o&bk̈zs'uBytrb&(3ּVM" ,3=DvUMU 8C%[@ǬI:A Ub,pq@2LFƯd#Yu6ZW,kSi庨:Nz1\$P6*'QI oa>r,~І;ϘB"bo&X꽊:[ -Gˆ+Vf4f1$Ѯ7}v䄜D} uc"Ti0Dh84'Su&Q_K.4p=p 1LL#9=NNZHl./6į3N%Zڊ,G3%'5kzUh7a.&-&pւ̇,vbŋkA:Ѵo7e7v&҉IkAY\L u#~[&Q\[5;GoǷ;RϷzβ#ZB) ϰW_'z\haRdZ3H$RKKR;i6lrZݎe11 yۜHV5Wc]'icEUwF;ɰ:)+qWXO^6pDUկcL.l[tZQY,].z-"+ulО]%"qs9YVM/.êh}AbK^^K_\3yWؑ6WQTyd")Dqw0j9?8Jy[^mgf̩}'.l_Iu5>XhLzU7[v?Ɍe!R*aKE4Q,ؓroeLJRxsYLDI"RfnccP$C-3(iTYm(R`(IR@NYs{bȫ]lȵR{v2tAa@=؎gHI4iӘyt[UN0TAs+96/q 5Oʑ#JߋMynZڷn!Xׅc>k1:NҤRJc%cD.&6LG9Y͒:B7t^+ !mZ8 )) UFMF"'5{b]k7UL[[nX%rqndK@NBJ@D[b?7>4ꊲNҥH&%YA6 X168d*H!g:m.Qmި]r]/趧ξhCƚ,srϚRxZg[z|dSIl}Nܞ~)^Ķ\NNAQ9;L73?̞t4ko1q^K-1`R(=/Ù0\^$цhB "gSzE!R[f읿ߧלտlH$Htӻo띝/kp4[ϝw֫j<1`DDB$^C>RIe塴M@k|NTɠcX_3.4VbAfIaRk)83ܸZ2| a8}UE%ޗb"D$>SqJd.J`=6L" = /"g-uW4ZM&e: AЀ&h!Hi L͢,`+| iӚUz57^lX%1CC1 /GIZCHYe䧪Ԡ@|L>Flā*`prz{ԔS)FMWmץBXW5؇j WOc<׮"C"MXz.au J޲,wC)eoQ9k*6E=FԠJ jˌie!ymSOvTX#M'f;|D}z{wu=Gt3\O{ߥۛX#G s T)ܺFZfznp נ~3"f14q rQL\hy‘{9 <t/ßC k\+'66 w܃M\&s^v':cZ鈈0/?nlAy`:W C ] D YȘvxe0 4kX2SNfj15x^- xl۾$g>AX_등st+㣛^J[>C$*֊?2gS[b孳Y$-)`'hQ^rIGо=|ȒFjyɡSPwM L~&߄ۍ?_n|Q}͝oѧ{Xah;dcaW9=y=)= vZ?\˧]d4w|!)<;_G3^]$ŔtR =(|18bQ\B~<'RlId _ a e q`;_W9u`u(J[(4kje.òl y/vAVyNi`y_wv`6kX?̣}^K/2s+w5վ_Wӽaًg|a>j;w['dL':&4y~I%7i'M$ƚ^'j|#ObA?!>'If]@~#'3RBR-x, /ռ\l Bk@fVOY_D@/DDc9VV~vEv3eUz3?nKηoU>6ʬM437S'U^Hkͭӌ$?tK?nຫ qOojc3?ǡdw{"wMb?MN"H[$.~,Ρ/~lA g' RH Vkb_ى ' %FHNK\cqԽmf/GuOh>2ƞ߶-y#a57f]=ҢRuZvuhw6ʯ05<q峰T!#8 &c BcOn4|Ķ/!kvP=~ w)Ϣ_@4t@I5Y = 8(d$^sRI I @t~+YXIC!wĨ@1@EB@@'@I!~7@bHH9$a@pa6t{fh HOtHHl {BH 15r ,)+!|pyg;sіҹZmc/'ybin4=9T z[ugnSo[#;+q$#_y'ͿN 0]^-5Ɩͻ6x{vw8A 6N_?oI[ I5I-Nlm>UĞEH)O </}ՏTFBb !L'@7Hxh߹ h`yBy_Nmҙ\g+mzd瘏CҜҷi7Y-dլak7~e5W.]i;-)L@ޜxHPAHF!%r[bK5}2f̦~ɹ\6&@@D" ԅT"XERAHEYﭲbHP"IH RQIH$UϢ¤Hń>zBSAaYmÐ:yEcOz,&'31ȊEz>1Ԣ^:y{^ib#NM[3WcϞ۹hM4lJzغL7W`76g/oFTQizo=LIel_<|- k>GAϽ+X`"?EQr<~y^t—'HH|f܋MU~]r5G.>6f㽚9v+>Ld|ryQۮI"z;] \C4!;^悘u\\ U7۶X7^OuQ-{Le'G1a @=>cg9cH_AVp1I8#m[ Ag(*ʅ HPU" 6X(,B`d(յ0@a7a4ՇZ-?OQ<|y4AO\F^nsG۶Gy|Nkߨ+y98p}P_iv_ڞ?F0Cl}0v,Y"H $E`E )`D`AaYI$kWwh<]<. >į+ꨁYX@˥i12YIi-X!}veN؆,?u@ }uzw$ABL?/.vx cw|ft}/-Bb٤fϙoG3afsL/(Ż2}8a_kK9%@q,ɾwUYHw/Yekzèdk$8>z-Z=]&[#`ɣYL{XhŊ#|0YHU@!HK0kv6!d"bڛE8jo>|!y.y-g'"?^ GQ=6\udbk?y'_`+cM\vBaߊn wB cnBsx6F4Z5X4RjFq^A:r((hz4 U cγ;hop2r/%1]h[jM)s~wF)3MkOW\b0OS`FH)fdXpJ%IL?OGLGot9ݣ<kὺGŎN7j;KvRy5G#ǭ}<YLD?!6CEGӥ\@!JRZGI;{ƭZIUNC 4ֺH0$ߡ@i!$lyݽ;屧!?/!MMryشd5@$HuZH' !@ҷTWd ܼI\OI $!B> A'[CpQzO]а.Yґyt:sR5}U|Sg|<WSL1)0T##KGRb*yuQ綿+OJfj?¡mp=I F9H qCeI\cE?lNnyWXJp76N" Vmo=g,ǎHnY1K]Tl鰠& ~dJ//1rݟUdn5!;?z}QVmt7+q\Yo !|dmoρV 1N˔ƴ?$04@ A &Yz_)4 eC wu̐z ǢY?(IS7ȝĕԆOI2N!? voPĐ $D CL  輿|'yz'CXvu59(2M:suA./$_}]y~,a>x~ѯMlU؝F&H)(uml}\̻=VNˀٞ+DMO(qmz;u5(F:7jM5W:̦|| R,APx yg$ #GRH8W.6~glMDDD!~BxY:P$#TВ8Dw:v9lObMģjgcï[kH5;'XOq;eM?,ZJxU:@X׋J=oXIm^c6[bGM/qs݄\U1Ei >4$֦#d?ʪ6(|ܴn\F|9Pj*J9gϕZFQL|{j4lV"HQ&M*>8/&I=fm&˔ABպX PX? .tO~PYESاZ`~~[r[5GAC#A[sfcc/RZéx8|@C~>,,-˟qj7GBi -#ebmZtW ,9=k-؞2zݶ#)?KĒ_;f}_˸#r4%~K1JONTF0YMT{x 0*<4M'TYH +ul l%9%8+8sRUb~+ZRS.߬/)ff= `&m$tWϖ.õ0K|FY@")gvmz( 2MZ2 ; * ˮ) %*K!ߛ[=ZD)9ڙ,[|~u5:Hb ^ֵo`16Bfo1;ct1oލILf0QKfcZl!c*֤Jr8o-jSBi\]WѬH@o\C2pQ[ïcpFJ=yc䑜3#cIyd7 ʨ,ZT\&@DKp;^'b!Cs2MN$C mRHq!#$D j$Baf4%*WDl[;qif$M@ wvRq_<ͦԥ% pe(~G=e_S?o{]!,kp?~TFhuW s)BZZpU [;֋v;{LGOȭWZE6#WQa1tƄ)Ry@BXʉ28%>vEUMpȬEQR\*`w0 ~_~K˾zJ)_h1@^ ) U6lXlypΜWX hٜ3dZhWnZ!v(ۯOz쪁 '}iNtBޅ1VIqD–S},P1Jr<VT{?ʁH/#zڞ+mFcPSHE<[ٮjVѩmB(`^j]4ݷc˱+Fr-JHz| Љ͔N `)ؔHld7EO&5Nu={<-Ѹ,3#et m˞r ruSHKP* c:pvܻQ=~N*54ƧJTpL=׶ 0 K`XAd_ד:jWplY"Cr44rHW֒ hmz4(&O&֏'Y1ױ.$(ym%6:/чؖX3amnf5H}L`,>Nw\Ui Cr(/VX$ҦA!fA7Zfu5𵑛)3dQajx2^Lu%I෹߯h=Ѥ}fu{>ZU+{W1POnWV]*q @IZ39nH8Y\)}!Ff d m(ѵ-8uai[ۖ[<:עi.GWkn'-x˭ =]R&W n 3|1mUk;L߷ :B uIF*?i&W(!|jiqw'1̆1I*ڣk0 ('HqBV DthVd,Kdc~kHiJZI^޵!8ǐ:P7xnM1HLU|6^BqO8*w9\a=Y{DEoW^Cbw_R'pPmŏ'fmߺwK}y,iЕ`!DD9B̩Zd䣠zQoy#>d#Jg/ꖅ #$/6hXTŐĻed_v3yrVyI@%7(M.+z)nhSWVndD{ƛ˖۔k 65l~'Zs^S &"A6ӯ,zǏ!E[hqc5=j4)x+[2emr5m4kCcyvebgCqklOd}iv\H)7e<,D C5 q=۽SrǣT _ >S-5sgeyr۬.Kz}FDCy~J'nȑ;#;_"ƠXM81wJgn1k,y"CkbDw#{y!kS"{\074tm0tr<Y>m2i1~Ql CBd/,ZO.B G6FWx:vSɥ jTve7EqRvEǡ6m75T*pN5uۻ҆b,{lYRlITᮽW *> 1j弗on#Z>^ 8+ETعKR8b5FQUClVϲI Yk$NC"epRـB*W-ҎkeDwt'"⦍3?@ZAI|{ ɅR& 5KZ6>̕ „p̾&[s);/2_"GT;j+9Ԣ8{FqQ`f ljr[28BsνO8D5s5I`bC=PO:]!2B*$!&;=E%I],͍[oŖh,WcvzDTfav၊w,N`ɥjEqdO81"4%6xBar$m] R"@zAOA䷛{PrbWw5 US:zvjm;ayŖ1唞}N> yBQ*ռE+HQƇ,1&Ռ43&y Af+|Y8!^ǕJt@cq1 XQԭeM-ؼcq9.j0r6E=];#+jΨ]ZmRWH%WQau~v` jvjQșWY`|vxVȎBAf=>p|`F# 4ԿGH2P_O1*UI`j|/']:&,Hȑ]M͌[m.n5yP21ӑnKOZ|)/1 0yKPs(8[[ Fv':Apk*e>f4& eEEOM;7` 4hGEH֒2d{Is-3Ɖ. $ Rxx|-8Zc w\2?AvJ BX;Z.TV&t~$ Z-bsCg',!ϵ4v40$:lz;TBS#!MF^G}{CݥW}t"twR|Qjhn꾰nAɳN>Nqz k">y' hۜTo֖.ġ d&[Ùc^Bln»N8Yewy~/BZNÁBR61?溚Z YcWۯ_"::"|uG[{I Eܧ7B5qG&Jɝ?> н]NBƛ'XPQ~G-$ f>kIw?K`gɪ: 5LR/~ Ġ 4(XW X,A@)huɢ$$~gT֯=N32|zwkMkK|ۃ,/}kgY{J'nWl 8ooĝ?˵mhi¡ $' )kAq&r~I:_fېjL$ՙnv!Ym ZǺ}aUz[_ɼ:yYK HU"vdFڙ g:G~rh1xtRci|C7PO.73< X>Udץm/9N{|uJbYtNt{SMmLN$@baR}:@8 ;N"t)jy{X82җ`a W~߃m!͟Vv[\/5`.ɵC$ѧYmW\]pgDEpQ[^rlةrpg`d/c.p8̯Yy9M0_Tcsm'lKh>}R?ҏw|՛k\?}Jg/X :_=F{+l)HCӿĆ3.PYvIHC0H~̄n_^u`D[I=,Dmڸ^B 3v)nC=$.GS]'m>'v>_̼wixf7_7ˮꛦbw-yp8|IGVgZ ֫G+yٯsfzKƃU"kL)4ӱZnu>CVǸ[OH"-8[mj62LHaw'L/Vg# ;zkuSr$QA:΅+Zlx)=t$] J6Ɍ"c< ߞ?fxYyWk_wcit˽aJ{O[S_|^|h=VqRVr߷;U蘂ZCDN'y"Đղ0{_BOS`,@nxSX .Hz@!g Kz: ! IlzK%꤃(?fE$d' O?$,Œɍ a$0.LY S BHcu&$&bM@@ٹm22YT0I !1ADצ! 5z^G;6֌?Ac>97oz!8:G_af[8M|;5_jmO_cra(N2aM @0)llC̵wy.#U .C "zlT`T~D>iTS\)*qrU9>ω%8R3+{cB؝KuiyQ<}O".o a@ _?W?l7~Οo=^Ն+vݿ\Bۢ\G߬bYMS̨"E#6$ Jqb@%&Dq-I]cH was!G~򭍁 %[bBR|O}tL I'2fv>vPl;T :~i$vifEt iI}Ǭұ$=̐gԇHq`ң+ cdF%׉'duj̣㤁5zN9yzVsJp;eGb{Ra]ǗϒW ]CkL831[EkY:f '"@!1 ̞WaYՐqiwI6I,//~ Ċ$FҸa>G+QLD:.0W}Up=i{igp/ޒr}3퟉[fv^/Ѝ#47ͭFk7R;\=7`bULs18Y[T'=z~k)sA̓q;2m!ˆ ؆TL'v,3\Om(7E0,۳jn160 +C-@` )HP9!ҌoRn+m~> 4ƚ\⸈f6YSYU5ςka21?¾Ld? C5WG!+F)ب Gw FE8=}i EPT d/#N}TnJsVOqq?SFY*ʉQGWf` !^huߟVwczǪY_M^/vcw:v1y~6e2?/e?nXh1O'}re0.Ͻuqt @>'&h2` Eh=~~w ICyo3s\Ia ._;/g!ROgT$I~=If @;LZ7V{r Nz1:{E<蔀y"qouicZ_ZH%)9WNK1OyG/7ve3o^5UVGq3$YѲV_'_l$@gu3zFq=xOkA4N>? jdyN{$"rP F ʤ9*mDwS6_3K_;wFߌRnkuTZ|D2չiYUtþ{Xy_v^ awخiWѳ_`LH|_آ 2W$ mMeH:ki$w !00B: !HH5N?H(IGl||Y=$?' h4 ]F|@} yuƱޤumߌe_bKNrW ޒg+? BbymM^D(Rn:-%<Xb͐XuȢšE l[ch "yJܘ|U1,>^@ƪW`Hd( #-YφoL| =ʒ ZAFҡ%EBdZU܌wc+i~3_oפ|zhTK?ڮgr(7FBs LL8JI! EDeaU`? >-?+A wb́6(}<\I=IH@UR!<Hm=s _-q_oN'̒jlw@kqU$tf{!6L$7ɿ25Baɹ<3tOYk> u4}qU'!ZS>7ݠur3|1fB56Zv}>S`]SMz.8?B8}C&x*̂U0-!GYz++WwnuxuMgl?/ՙY z`V 0A"(/wYKK] nrFh5m{CyW\lLہC#biu(iAK/JX{bsq|IjYJQN3i1z\ !mvҾh ݞT7  S*0H@O٪k \*]8(JbP|Ok͗ZwOֈq=:s8g6D֕ !u£VZ <ů]8 F߸ܦN,1g )M~4ͭ$_4?Oy>z ü~m~]E[KL\U8^ˣ˷r9)W4k “$c9wwtBhNܼNA97XyIy>VL(ibʗY4Fm*g&}&7zVXt7?R_QVZP*D#Y0"K-cWb-e+#)ܹnn 3tn* lZ7θI"V9V+ lvw=Y^Ϫֶ[]̫%bR_8ȮvBvsBEj \wR˩ wEGjgh޶~_'/{NB,F _ c%b;#b ~jPtpBE9ndvj$,&"csP6(Mh 6h4Hh d&ӭt~)#+@jaCn5VqN!)wj&_cQ{o{ak?3oZl;}Go)n\}MC7[NޗRٽNʽԺ8Os3ߟG)ːOV@1:++abxNVқ6u9]gYۢIH0>hR&|㩷ף_5'yD{h{wZ|t8 , 44Me?͋} j=}\qWCŊ1! `uPz3kZ [O۷`~Iђ^TK:mն9ފ^6c27-j?A2 Htuoô U)F&P^٪>I];p}#l(dЊsB!tTq2T1hc$eG Sk I IfQI|_DDhű$n]_2fkhLɱpH+"<O].^ZH8|DGI!?)-nD#Aەwh2H- CCi1tV!oW>W8M/)-8ͣI@8HZAn ­i( %C Jǎ+7]|a쬫nwlyo㼗{}'_Q1ۨ KvjAdXI`}9[Ӝh^:Ǥ<8{LVɞJb8@W3S axRX_i/C ʴzBt~Jl_yW C'a}|ωCazE6KQN/gbNݭĨQ}o{?vh_7*hoǰvegy;w'2o)=@02) O؛7 3~m58 ߰lW`LoWZE=`s`&٢Q N-9P^Wqs_u2p5^NnV]-]zv!赾0}8%oJ8,%t9I@G-<}gqN #xex~~2S}`LGBaRCF@"LZ` ,åNzpe9tdH캻bc t/13 Z&V+_wyp_mmfuj_돷J;߮WYc#{67YμC(d HBPʞ@iJ "8;*p\^uMC+w@|y &cgsր{n6!&u!L J~5 $! HפB~@?aHgV9>- |!a{22IH$/~{!XHKK?wQ4{f<1b[tLӊ6n4_c95T*uT[)m7[DJV {&AQaȟo":A-lv7^ l߆FmQ rh6~M%|:HYU\_xDž)A L=yQ!+5 \APZ=Ms/L?Gﭘs.WLco}FpT0ٽFv)8 =n%tj 4L`Qnt6ԒONjByW!:Ǿd,_(RzG`7I qŰ&$GNLa^eRHaE, B-vi!;m2: kɞzXgC_\oKe0g޾@yTi j5ZPb4P?-Ig48fT>$TՎ57cbݫ^=\Bݥe x֡$E+ ~$&_[,3-ȞkԾ7%IuKd1 l w7o[x(95~^ͻ[qK%[OF#ݩDՍ"'%Vdg06Ɍ$džƐDJ4}ZW__e5^Nim;CnSny%poIGc>oOXRetby"BG%tc`1 &2;gVޝDaI{>}^(D?n|#A>1iqK ?Od\_-u>ez9>Vw8K&:2` P>z[Adz&HS_>=aʜi>/휱sxIHa% >1(lu^q#ڢS瀈#CbdJJ[=>jsbm]s\d(d  ߫΁H9HTe1ktdq밬 )CJ dSoSw}2F-@g6`Rv3{[Z%1)ʃA\%Ke͂B5(N REjp8zNiG*RH\wOx&EP&jGeTD{WH4=a鞹[sɌq`BBWN{[=ga5?>gQ?>g=h?O(ZZiŜ*?As_qX<'ϓG7(>)G}U"T*mAux'K+tҹWDhM~ ],8S"_Ky%Ɏ/vD#arjS7mVDЌ.1S 6鰐s:'ʈjce8m- 򸓯|䱥aB &{$fhNOK\MLS`u~_5Q&^j(+H؞)?vNQwgvߴzNX F̺2Vr^b(Ǿy*6T1}eGǥ,YAj";:!j4Qά{ҧ/:LpJ o妤U;ܫ5*3$MohpqĐڪR?_"OusmkD6FjA WG͡!Av\7TZw`Sm[S4W-'?Sv Ka2jvom m 5B1OhJpq;oGnYԵ9]vQ6D'Y>Nm?%Lf;5_t0+t0&dek{{N&Py$tgS8OtO]XGaNhK<:?U4,[8TJu4\;o('lCI;\7vk;B}+qJ DBHfM ᰝ~e,?.$܀1l¦Z^XZ*u yҞڈ #exDK{Z 2OQd&blfIDqhnUm5.3K$fs;)zkI2;8^7)ܿZ `EI~xq = _X#:EsJF8\AIULC7X@̌+pM컫7n74A2T !YgdfׁX|ZzZI!<GnJeʓץ1s ~:0n|EoX X~ѳugkkorXa]8 )Ƽ+> A!]aN>>&[+XTj.-nӗ@719^J漖P7OikO݁+R9[Z%̖ zc7Q)k5!X j۶h{yf칮`#Q2Yص=+k/X,5PY*6q)w 4I] we v$nmłxn<ڬyLSy|=w5cPuB;jt|W usRC?N>sLR4?:R= ONī  S(`K-%bZʔ._"xb!#ar1_e'-DEVa1%"!B2&"MT}oVQƠE,4^l%q@X^[;{KZgоߙqD}W+AqH^i#(ZvءJe$pӒɃpG#|ulp(:u y-2U@ڈ9vK-๭ F`&yG;8X6dA$ t"ێYamAlN+wv>酾\- 3V⬦kUUݭSQ@٤Qsaꕭٽ_c%[t>fH FnZCv–t|V@9TX² E[aLgڋ 5؟f#Y>?i鵞Cʐ1$p{e013?!`KlW mUWB8՛V)J&< nz'sj{]? f?t z\@%=G ^i/q3vR<{c1 Gc`)ڃ꿟ۗw;T0L;e ^4z{H$fi`a$S̅OֹY̵A` $(PJ?A'YmLک z~vKn.OAj: z $$=dJmkz<#@x2HE ,I@% C'I֥*% ZM8w!:K`^Tfݝ':vs^q/maM'w[3:/5 /⻣zG4X.0y~#(kyM$0M{gʰiEZ`еjX@ >eD;lFIg~MH^ /M:@2J5qqJ8}L(N-YG}CC \L+}u4* f`ebd8jJjddy_7[\Զ+ B1j c19~[ҩg}T֜Uk\'g|ow?f']5sUI|>vå &;^YQYh HG'%6"duz=o,%+$N(`(Au~v~L u阁B;j]UT\J&c $lDiϟcP [DMuKqs1F5DAN ޱlC}vb׶kKeV)IE(_M $#fب?kNE2M`uk;P n(Vq8"_mM뉔Y?C-}Unn?u\D;>i55q|槫q0?{*_@P P>,Zgh@؛}Cùqt0r ?>eGi~?ٴ$ =H!!/ᄙPځZ I@@"'GZB3^Ր<_&E%eBB;~ޛmZ_}ͩɊR`"PdͼbDBi;WZsb?+lzfN_;ݍ˃A]5Q'M;rμE>`13vScam/ }QHha2Δ~Whs=b<(v K$G=%fghN!#VN01֪8184i1k(-ҲY$0F&,3#8_rqˇhmJdz#9s4pb"4SIѱ>dgR7oxOI C!]<}@;%[z&$5l$^~CR6&s'T\HlV8?jؘƍ3I3ݶ Wok7?<?+wh}i ,īHV6yӿ (H#?,9i6 \c c7oы;7B~, 42+4EPx76>LXQ$y Z.LgYaBQ%ko ?ӼC}Qs"5T-}pxq̻,!)Dnj'ߙ_CF`A -(o3*HC6PHVC0OpVՒP"͎]KFӞب`oL0H1qȖ=j+*.% ̜LR ý1 K.O}yO9վOC6ɊBvF]A"7)noӿWuj &"T7S0E HZgq޾[[`w,ZA=E)>\~*;,3kpxu|+O;7ZmoIKh3C뛁$#SlBaOzs&a^Ӿ(\P0,c辧sxEw1).`<)Mse hv:!x'B ŋ=T+" ; p?C('U#Pkdk9?!#9OŗH?U B+5"= ͜3dD9?Uk 8bC_VTqd3l5ҀLdarR&圖c}8KP΁ܳ&:oKm/45T]?;uq2dt(DOf:=o3mP y~FuR RO;U N u6|?s&Ñ!ӵkA/l\-.L53x&6pAzh@ [NtZ鉫aVť4ذ62j)!Y* &e1(XJjTJ+jF1" Rt DTOyeƞi:!h=Sd<֑eBǺT]K!yAP51  s;IM b$+@y"Kj]e_BB?8HjHB`B.Ѿ ?'W^ RBmrCoѽuY6~OF0V#~*d.s~-}pB{}Xr,~[4{W]]OTetTr~]pZaǐD_0!3qo \&K(^\1KB+Jj"HJ45ow.z?׽H ^]q{(9[m+CdGs6<ѕMjiv5_N+pr!{mޚ+5+uŗKdaa&2 9 @'IERgjWV]ƟuJ!Y(4D18tM' +6yڏcX5 Eb#2Y%-vl.o>Uy?#wf4_'?.ƿoacKv@E.(d`EAN3?^>=^I^,GV&2mC?;zx{ caE=ZXھ5˹E!w8&30-}j{]μ-8͆U''ê.u!bߥoZ)99ů=633 GV*VmԨ#8Dx>qĪ[P}]FQU5nFF)6 sg"2pݢt^<msO{I1"4GۑI!]{;$C8aTߎӾM(uh][Cڳ3\}+qLXE"":;ujj95vњ^d,i:)i\%WAAH}ZQ c ߱Ʉw*ӆrH](:d`n+3E!i}qSys(97CD띮KiI\u4!7w~^v7laqW\ScÍǠb&HA} ~yć$UGhD8/> ) D}.m.Y\\sͥ+zzC=_B%++f*V"BB~$^tMyWS/x+Pց &\K}ϯ>.,w;''3Dg888_Bʉ£*R FMޓWKԱd<~c@*ip.xqʚL}e0;jET:wV'[ǒ"I.=qE{tԄ;lU;-g\Ń!?~rsg,x,c}y:pnZk `l #zBx#cǣ?M]e9T!|4}.av2l$ҶdB,vM} uL$KNwD;i@r d$,KuesY35 & Tbh]`` ֥&qUIDC؎rX2|7gnuCʇk;FpOjȃztῳdq!Cr72A5IF0rE+>Cm tEHT ""D ҩg Rə 3i=/'{lt@$S,xD"٣&e ?['_c'S7٫!Uf5S&DiK_'31~C'Nˌk Rы[74A~B:$\oVSDKs}4%Ͷo5w٦ u3XH&ĺײUR2Kh]kO@l\Bd;]1>YTYWqG}c2]pt:qV)ҧ_u$A|Z圥U6~4!Xo 3eR:z?Zg&WxrK kI̢q߹u"5k?a+<-OrOԅ6S kN0'Pkr<AYٔ}Ʀf..]fcEC(@DH"dlTq$չR* K1[J&]SCXOE5T{}BM& ! HQ*#$?r0XU  !sw'H J /9 mo6"zl?xarxfd!;o^|iM{y9IsdY f|812a6It(e"{勿JrRxԿe8!]Աҧ;ѾI0A__aWU3y1ѝ|6,Rwzmɟ: Zp>?a'Vw&xoR/_mk^Ѷ9w-ـ#ܩKsA8U:iqțcŬџka~l6 k ۉC\] vGR'uVqvW(]č1>:o3)Y3_ R[{ 46I ÛQ@Xw &9g%o‹uN4hѴO+M9Yxn7Lv$UR%-yhg=zAj)bfR Ш1J>B Xiի(WSr@BXMx8Fw$Q[sLRsmBT^z`'R}ZD %۴:ˎU_G_Z ㋏\Ëǟޜ=+ڈ*1dD=IR1QZ)E VO*$U" )P\r^<_HVi%K=t1 Q(AeIPD jTT"ɤ?%s4+*ǐ"I0߷e R=kyȟ+ö񘪆>7Bɨ::*ʊI5f"R#f!U 'zf$$߾'`bVZj7+\})LsRGӡ$4@>{|\6Yܛ&-='ABvI  I[>71/sj7#B; v-xbէwoDDZP+}|}ӋDȤ"ӫz>\>7hnX^$$*9'#EȂ(A kQWj9$9FH68"MBޞZ+&Kq<4uFq42['y rs  io+|=A2u9ߞb1H dHHtz9/VꑽW|?}ݬl+es܃J @!*O.#ux?ԯY;l]\ E"Ȥ҄??e?Kbdk ;cT̟{%O2堄[vvynnZ}I$$[eHIYRCe%ب3A!h㠀i -/H|'k`z^6_|/M&n^r7ktϣ ŒyEZT{}V hwE?@ idЦ:jx@#)E@̹ <eK42noAAG|ⓎWl訆nԆc X_1%DBB>Yz >;2h Nu1z> "s7 u Rrg8+v7a(i5?exVD8CezNxUo_qВpPZ~rx@FD@ly5oBZ)m5:3<qFrb GfL@HA@QQ|J?g_]EW9M˸Bujnn<_LJh'>Ǩ?B21_P93!J*bb}R!!1G_]`i~\Iݗod%cWi[ { 3UШDT#F-#0|%#v\wfr`T;Ӯk.3ߋz9N|+-e.GW/<,YMQUnm+:ۓܩ|'fh:2+, Ɔ$8LHQH)BȪRMQΧdaMҶf5آDHLߝ8q`޹1ӆ5<~2_7>D"S-jy㊃|a8h= W6`쒶*">3[]kJrYkaDnijZS2(g<"wǓkl 0/Dݻ $ys!U=*N6QqϨ-Hc8H%MSͽP҆ cHSL'[wٍMyG6jN s/`yoVr?q3o r,y=VS&p }ҠfeWh2ɞ;g쯭Vo2xf|5G8 3rhv|`ZN󯪡?$(0rRc'TOg8^ϻ[#_yɳ:^q ?*J,\5kvyqJuͥpP)=Ҩ62pNGKJBv˫ϭef0H/]Yaڬހ:ܪc>P8v)ro(U$kzÐ5)(F]to h:|3` ioVlmJ(89rTdzN 7\#˝u7D%¹OBD6K-EZXCx=IӲ+mws(Pis5mvOQ+A`t}9&6nKj?xpCۙHN>3Vq"x(z3aBC3 h+dXT\+I ,}wPaӓ(fVLE+`4Iņ&{4ҼG;  A \LD%mPNVUŵq:O ,ٻlX_Foh͒ aGսYqbo`#o+cU͝$oauhY־*C&=*-9 <10"tJMdb})2'g])}B/edyBWV\n&UOұ5Xflx80dzݥ>VmB9J &GY=\E^{ѐ2 \@a æ\JZOīQgrE ;@t#7 6-*YW'6}y9^U6(|]vь[Mc(VW 3R)y+ZϮ?7ZbF9b4Q`IambtJuWV&(Y%oDž/M & `Q`Ylg JAI⢩bbӝX:?+79=Fd@d-2*8\0T%yЅ%x-sMi'yZ{O"MIdx]Fmv[9Ŝm}?v}MJx-$g.gRx}:LlsFP6h\z{& SuQ-̃))ZNjc.t!1ciϛ`Pk0C dm=K9kvBZ$ҍ ŨsJ:yXd g˒:Jc'۩X@0@ ؈0 <Ysݹ. GC(vPvb֫/Տ0g{n= .~ IEx{6Ӫ;f^w2]XeƱ_pUKk?l? "Cf`a!ǻlbxL![<&Y__t5!?G| 9qHwű@7!2PVqMvZNVi~-f'ch'(;UJkPt,1 $QT6 ^G$VcB 3LPHD@D5yi 2f7۽DNrcD"ڢ6\jd4< kôO߾=Ss<77i{]8;niޓoS::;~z6q <Sq 1-2F; A[_1,S5MOƠ!R_gLyuB>܂I-n*"~;g΂@S\mj|]ktg4nsW- (^>"+ _3. l:'9 R D@$ob K?k o^{Vm};ݚǕ}yT\&Vl)~e*.U7HIk)N(yH{+f忏Q,'!B;KI 36$84V>zUnFg#>al"fQsK7Z,I z–:1YuҰʔm|&H c@b6|'ndT2B*/Wk V'ScaNeEhl]ZcQj['rQEGvsHFXA{ymw y , ! h.P#|u'qL#)(Ck+͛/x [gmϱ{Do4Z/r+f p"m.8^[v7K7|=O|[|myUoMxF=.XULFz@wσ/53F5 A@B{K~TG܌‹7Y#8f!RWe=Js> ~snQ d;tl=f>KY'֯]/\N0HH'T "` H @UEE"1CJ" #$>\I#|V{svh01J[ X 2J_kw4컺g~T`B'}VqQJxKqŵ'5$scGR`/_C_9 X}RcAzFR"<ΔdQ'4cg>BږMG<yM Z >{ƜNhE*K-oodj\KRi )V?wf ]%! SbfsnqސK! Vұ"3 9{"q)x$^RMo;z-XAAT"`*I%_)6Ve2*8x9sZI^Boɿ&e/+rkKt:dS7gg&(1$"A746'|6Paj ID'J>Cq]o{ o3ޑ^}= a^Us!E ``b E( UPDXbAdPDbH* FDEA`H)$X.d38rUDr՜z DFsޚu?ɩug3XoƨKC< cď$xxY ̼տQ0TpZX+^0c:xȀ+и=Ď诠 6dZ @q$2%11>aNC $0?h*l0Ġ zg2= lP32H K>ٻsxLsuҐ-usAAű^;qy( M_i3ivN%IloJ_D7]u͒E&rtU'wo_OPLk 7!9]]@ӵmڠ1׎[hI7yv "w]M m3|`K=p{R`ĐA7&Ej9黼QѢKd(U>#-H3?_N $ dxX'&ɱ]@tr5뤳ng'hW"u/0뻜nYezFOZ ܃YaZ9/\5|g#d uk >z0=D%N!B@UgiNX Wec䭂@ !Tֿ^,T 77ݟC~쮹 8RNi@;C@oTcȝ1sK3eӁ`&pu)MłI}bM!{ve3bUo}׻Qm'W~שl=ӏe MD5UajZк`@9^@]$*E؋Sg{]uzۙoShI9DE3!I S'L64vDE``wMs}NGͬ$~^c^z>MiDOxmm~3?.k7^ FV/WiL-4['P%厶힧x331Ԥ7Gv]Lks7/ 9R80da@"< Q@L8L00퇼Ώܠyߊ 6clkOLrѿR ?3@rB.$3"2UbL6Vہ`i+bgBS$%Pl%;r,Tot*S,y 7>?R[b99##?>a~:2&.c@ߴ$'z;&3+Le[]|&V}4H~N;g@P0 +(@.֐ȦjxI$p?+ 9J%c%Nu4\zͤgA\ď~-v"dO@ikiXhVkcG4 {25x)JB񿌌v2[s*!45e͌$B/X~М2UǩnUbNI FaGA>0 (Z$R1"N׭ۤ[Y2dcDp6Cڷ*?UYf'mƔA:Lx>S(8%b/$c\XelIt\̮6VNVIĥ,ԗn-F6=+b,uu <L~WkܫϸodlWȏqC9D}Rxg58Ĵϳ]|:پ*EltdD >r]TQE)ܟ+3 .PSZN> $iUaLLSjVVfL=ӅB jsR%)ÙF (a/k '65+l3ε;8djfg tY%jCy Gu:蟷N{V5=:R0 6eV4ow4Ѷ5ޡB<υ38nK;eb%)PBmgn,m mR*$)iLFPߚ}'euS8ԑ'`K45isrs%NeoN?2Rqy(m j© L0yn=vf%e:>pΨ?p\/ܢ8d@w,nlh4ĂKAF h }zåU2olc[ &bB4dͳ+%zARuH'P[6 I(x4:byE'! w>1&\۞a 8=XπYMe;Տmj_=j]uHL dѺe"u9ӛGIjU>y[Ua8;Jӑt$Y)h7h|bdYvU(@uaZQMHm0;q9s]S#J\,T"kL$4kjg(16;nFÉjEQDaR(YZ" EP%D`VHŃ" TAb*{^Nd5l$΋yd{RǸrׇaV\ H/WBT+^鏂-K"]e fDۺV.t8)m pRϧ6 'NbQyzۮ3Je4:&񡡥NC7- `Ӟ5H)>%cn{;qd \e<')!eI$~_|b&H@~pi>*0#y*\Vc(o xbA\V]?Ts~4Ң8jެ0Q'/~4OvfD6 c6`C# <_^g?鰃`uYЇu50t6 7.?ѾCwձ_Pڤe~¢f4k ąs 7̾}5kLN&cfO3^tyޚ$!=ev,W7r1x_?qg/4JūԠ>ܫH+z̧tc6/1mMЈHzs}K7f9.9/@nIt Dr@ :-n@Zm{r8 <> ?O?̩|ϵ`+4wLo%~Nfi?A-u)&KOj(jG2^ M++n#heKm 1M ^uȾ-  J:3GةfXsHPrK$ uGt303%(j ~XQ\#]\q\ wIY(j)'e4}I'.%hgGS@(a5~|~lmc>yɿ3.Ժw\oѺ%rzP ' <"'ТB鴰G$ 75> 'L fU8)I<&k)ޢ&gpG$,M^&͐ѷ?1TE$\7:W r6q ;  J=ov⍋zX C​p#Au$À~n3+ aZ0 %$@-IȐ=LfWW(>( CHA-T" vVy\ )=̲J53;^}}XXss&{I XAgo8̝l\Q`.$V1HȌPQ(b1b0T*H d* "QXY 'AЛ\v̙9۾W+RS*6?NٜDˈ7"6!9M uMÕCPHuqCya^TCweѡ)#}K8(Ң*')ٷ^ͅr9ȭƻ/hP@{D)_-7 1Wucq 6MoL)P>aq)?9;mq`|gݫH6i@#d@[" 9~\WEA<_w;>Sxxʚk>j`٢Y`2CZaUdƠQM/\zuaWX͕RvYؓ9)KAH:|ܳy<<띰#9ZQH3x.!nC'F4yK'|>c/8GR?n]β <Vf@4 -Aߙ<vu4Y"Eb,bd A0VE2"+ab*" Ab3PPV !1 ( `V ETY$cAD#DV"Q`T"1T0XEC\\ȳ?"jw$Utev4]f`iX.iԸ_kx?\IL33`hE&HBAHxd6Ngh]!-%ѵOV| J,H_q0L;OU!}p~?qh.;p͝ yg!7W:U Ov(8903;h=cr*ht$|~6 G-:t#~uF:]vsؠHgGئCI`\.Rz:bA3j*4+njR4 ؃߼杽OηQK1F0qn$2sfYߓV O&'uh }Ow#h/b!kgǫ-:yy6nR,LB' DIHR }V2ȐHYbH&!DR~,JsS3Î_0f[@@;c/?PޮD1ܲ:|xwT.í٩fG52DJd =bQ8C[>zfYNyOY۷ PwW_ H$qW洵[jz7ұ" fjVIOK7/KELi_n_8*s"s[bUhz,'_q%/C%h3;n-R]~Slm6h̴ypcUrltԪMdw7T)7r+૦kz4d|**ٻƧ) 8d4z8nRF~HALH5f'WbV>x!Y#QX ;V:T_e>*4qԥIeTŕn ͳu6J\)1v)Q$Qn@sW.471M)[wgw3~ #˙cDWsbMEJYL5 'pp\`5/7ng_LEڤωU\W1@Als_> SiԱNД+i־ c*#[jjH~(_Sw킥V :^FC'1R*xLQu#\Z -:eCe3#dyMuV&JAAip͓X Ĝ^[%bNOի0ѡUӄ _QkHi7vځK_ x4H>Q+aoJX.]@;v -Rmrhzd8zq#ey_ `oak?6!& tAr2)׆sTUCXukV,)\L>$=ӛMҨU$~~TK(x$ BI;xɊZMPLǹEN?>-=ntdį#e:e7a+ttj$(ĮF24dhh?Yj'/ iJ@P.w$1jlb)%ew T$l $dWyX݋pCz3 f۝v| t$ VHi)U.crҡlA9Io70ՆNS{ ^½vg{%v.h V:gÕy<5VNW1a{H6\faȓ٨ǂg+rݮ8eCb^dW R% CfͲv"Nagqs3ۡ~Iֺ-0yAH ds-lאDV6˩? eɬ(xX'jcW5<{ɖ٘ƖpѕG߹Xt^bE*e(tsH G&eZhY,ѸaC^oq4@y$Yϥ.3Rr-X³p4.VYˬ6 q]qElI vH]`21M{jчd0v4;|bCoT1Lc hIwsad""'W@"Zԭ1A۟HZSdΙ-:u`>4a W&3<kACuU]8C/pc~ խuweMU#嵱(ՅKg|!c 7Ӓg_sx`0IpQm8D-̱:y ovDJq3`d_Yf)HUI.4Pg^ Ap~]{aP8] cD;r"&X9AYѯ5vGN~za;S;el[r&FdR,Y7PLfUe찖D8`k]n9I?Kj! p ~kev!QD$ "XE@ QFH@XFX`0AAI ,s  Bf ݟ,U3"8I7z{-4_70h8fn2;{B 4 34,D/q.BܤDS_ ^Ǐ(XmHCRb4MߧW" À\d5?4ԛL1Q7>mKBxU)C=?Nj/~xKNÙT܄ІeC.q\ [Cq knqd4m zZN>bE)-@v(־9N$ˉLP,SF+k\#T?:(+5!̧bry(jx$倫]⤝J&@~._'?㣨c8!^u U1H$3ƼJm=(EWPGdN}p.g@ @k$~Aa ۟쥥R58 ٥Ř{V9Fפ` Ă-*A+oet_ J&4Ȥi?l~8'֐,w_ˎyBP VYĀ(i81s;:4 : w8 }}D/ח;6F2"veds@z3}z[OMZUA%h;~iξ9{y +d=n UuTDw)&HDxg?/[qޮܭdI,6հ^2{T j8n4҉H 9J<޿wGR ynu1e3X" lCtw.Zda=&z,|RWA(`ID}?p`!ʙ$dk~o40n$s{9;tTHv/YD/"]pC8ӷ JM 6{t X{Rc[T{eb_HlgB64 ^yZ&#k&7>fZ~_M9~V׏-Nϵ{:PXAb ȂEHRE EH(b, AB#,Y *Cf{テl;:&h%v*\NQ WrUz%`*pptcf:͗X d)D`$c V C )*<3VϬ 雟aX\pr`dk%/05-o1]\s1cslH2Yf8(r~ڜO%@NԈ®'ՎN `zb|ՄR=6,<4"+bj3 q@6=]SR«,=ex~% `G*VX*!؆@堥۬xIP0=сJ  $a10WO7kyn5Ƞձ,xksM֍BynQ5)d= 7w̌4x4e`D@U$U *1AbȤa$XE ) EQ@PBEXYF "d/r<83FYOp!x>VWE - q! R DL$7xj0;o{d,My5\?2X?Kh hOʨmkrR&i"$B PVSG1N$iҭyTD ?xpuRB wLQJl~2| SWqdwL~|v7sse\17)/ q1"yHaN]l^TzkzdsN}>0EV DM@ik\]/HEdP27lzt$; Dv_S03 |qʰbCA"{aBy\ʁ2U̚\Gk9)1\@mS=:NUJTB”A(8JS:Qiu7[ߢ#u5`H`]u]uT^mYg30srLj^e6sUNXZRQ(D\D #<Pz`m dmMn>-˒?kqBDCXZtI,^|;ƣ;b e,f`T No|Q͛/QT{A4ihx$D%Wr1aKص'0!O9.pG:<`;;ofC@pCLoJx-DU^1+L!B cG_%_BN-D$4)>&|=H8 Y4ju8>gEA!] O\1>*8aręHϾQ K[+zY]=<ȷC{g.|ߣW=ݤ\uFiTV+f B"#zeۑakS G P˲Bj{곁GZCbCi3ݴK{nk_"u=R>oBdėAH|t y+\նˬ;3>$XHz\]&;L7!bX`U* MY~c41O(VD`Ŷ6䓿,+X Y+ך5uBzL;s\<;j4 qJ y A: tQʽyNZo|! @ $2*;gU>5irVX-b֥鋘GP$AfQ/n$G#iP0:١;;N>jyWu|7VP. d(N#&*Sw,=8y_kj7}JtfrpxxI9\ A=׈dbhKȸR=y<e-^iat X~kNtN\2Nqs< V3'{%8zz7}U|籝!ۻ"z> pL`m$n ^i I`"a BkXEl]ѐ!k $`iJPdv>""S qd82k,H;5vVi~H@/boW~U[C]Im1kU@ MXBIZ<Ⱥ; eE͓5H. $r]+TgHW__ƂI]RgqWps|>f_G@&8ia8'D?e=LFF I1L9y{kyWq/<b'|x'UO~h:?g))j}eg_{n߬˨I5Ʉ_mqN1<5q(ޠN}iuwWp7|!өPN`a,ch|y߀_OL8YOz{&J`m0w) vF>eVw&qj> & )xOcTGy=3tQc"rVTC Oӭ9u]GOC@8x,‚\7WJ]H9ZG,!!9Ygbr|MTc8GӭH8}@ P4c6ʸm2Ȏ.1ω37/p`!Ehx 7Ҁ9sOOabd^i A xmִ}BRnLσ8Zb~۾6n J"X)VMs6kՐz=eXkh5YNL|%߻Y̖,'s,9EcuQ563ug4:ӡYXoEI$@HgL[mR X9`i?4=v6c9b ^]cXxB'R A DHJn\'>Ўۭ\ EGj:Gh~@LGaf0݆$U?3֫` 1X";"A<’= ")\w.Mlށ 0R} fj) EENZ)1 ٥ YiRJ+ Lb $<"2HW*Ԉn$^\]+ä$~\I NPЗѺu *9ts*PfP#~eV J#̨i-DdR 4?~1{GFsj@/8.Q@긭ep>O r D_%MW}[{Ct77ȫf8R)-;0QD`)}qwq']>Σ;:?屍䃂ZsOItunl%'dح4\Y/Ȓ&bu6)GK!n3 \C)@\Df|_kgeqڗPbk=@5ĽG(Ac>p: ;AXO}M |F^ԋ)|X;goE$9}y!xn#(o1⛼n] j&tq(3uWiE_j?'Z"FB R>hLb8DA~ڊg`tb2m}iUs H=e2 }j,؆Me1"ЃJț^+0,=Fnyq'zt0{O B̑ _Ƥ=56Fh4r ]%yZ' CXަ %\`r:,u$ut!)HOY Hj3 Nsݜ[Tm\gs![o-5%Oxֿ^i;7ioK+aeĕTwVm6L' PnyExsM5"p<*s+(#X8Rnc[GLUظnڬ }wSk?\t"6f`|&:i e^-wYW)6HpLJ~Ŭz e!ԓ{+ާ~.aڝؑVy.(|K gklH̭lzvAE 1h~r{tu.~1!̲|31YFDD\B-72t_cC^gpK ~Ҿj%BƭO_m`CFI!Gw::/%P#cLz#g+P 6m?8e*+R-*^3!"w[(N }>sO`$#iDKPdr&. 47BfK`Mo27S6nl nA MT%ޝ+J6@-y ،1Nߔ32qV DH7fT)u@ǗgPqzk0cAa9r@l & X,O;91n({=81C ӋSh4N8[m:Ky #C^̀f6/<ʵ uػ7RҿznG\r(l.#d#{e `oRD$.\ \u;Vf囙|ɔːNFϏgqO6Vt(i`5BҦ^l, sJHE<$`fZ6d,\f:nTbQX$%ӚbD&P;nQI%2*%H aBjC$0Hb/\ӆaŅVZ]~ ,@nkdfPH^% Hֆt::mDʛx۫iB#-[PQXJUfC"WLqƮH!Ya8Nl̽#&9@p.w4T1UfL<=x26+g6O?@XuyisNR*\lц1aD`3.|ѓ'hNyr9mWC͠ mXC6rb*<:1⸳ӤO-Mø}ej6hiis~VfGdc_ޣRѣ h +9/x;9 y&` S}Ȑ .}D2CXmLqɬɢ-qHurxMP r3!Ji-VpV+)# IByA̱!ykcD,xYLCFJ7Q13ΛX0r 9 w׹C#B]6J+`,,t{aBɷ^| ( ,b$ CӎW%r#X"$S%Qt1pP3QvҴquc4z,:'T:c!'L12 !tb:sqT㱱86SquQlcXEv? / h5 dvZYT$h`5RO==c>~ʈ5z_N;||!ƌ+FAAbb ܊aT('w4rÓ4O[ax3]gЂFTԴw[ח1fU*uc2iX5x5;?ZsM ShPBd,o\UjJp{<,hҨ?V{[JgXI(B+ugzlR`:uChV\7y6TQ5knb֛ҫ[yy&8TQHBr7@b{bt5{S<zM%!vkD(!m$o[x+V؏&;ʲtSF@yE2p\)#yh#xZBhM-$)WO1I Gߐ0 s;ǛhG{C+VwqjcpbD`A92gCj"0fR?~\Rh*~_FM"$9tڂ6jAX *s|)ȭ"W{}MFoד"["3؇ ac{}rvpw6ק4c"H 91Zj1%bTI^a+/ Y]ǘ㨢Y%nD"U!ypY:p׻}")쵭}WC8GS?r@;G Z\O-z&6,֢ryeg#m:9BdW^tXO+\Ͱ&F |  7Q%6fxǫ}35-ǻ)YM#"0wuwoOҐ=Fz&[z6jh+Ȅd <}۸k7q* n2 RU4sdx4zB #דr{Qd+$v`vR b "[z8,OG}wXV)O kR3s8тB*,,;~cۋxl/P*@d &gSQˆU19iČ⧰lv Fe7mGLYoQJ iWpry@Ӓ!Qn4fx*jԗ[[7ʅix]S,S6J;,b&crF4 b/I{_VJ\{IGlAq1@Nl8 t(&d&Iyy5ڟקVZR7onGܢV[E2 IK5tUW;GQKnE! e*GcyVJ媽ݴT+%$~  U&hOȨxX MQiAlh n*Oԃ̋Y47zG/᭼u$#q1qGnkpBAI?N tn3ː%Op(yUؐbޫqҒG 3'ml)f$78.o%} 'b2 m"e/ah[`rlFa(%-e]c<-rc] z&Rcu a?XD"F`SZ\Z,u>SCN_TQ66 X%^R] \smXbl|K.- jǚ X0>b@ݤqs`V<VFʼI`P@+51.fkTyMDomf/1hod%(hְkgb[cMgbHmazXaeg`x@=%`qNDg4 c9#'6AR8F jU06-+.M48T6:1i e L S,IY &hq95](AVFȜTC8X5 (6D2lU0>'ԣ_z1{jHMy^ Sh [rna I6$" &:6NtB$bխ+j2VB+PUFqW'E,Qy- [8@MEVWH͟+ -@XZƀC 251*8e߇ePXTx0_}J'zi8j(wgc;ygf,`2`@ VPP)8 +Yo!UcrQ5$yno?cQNFSNRM)!MOSkuik`9WQP!;z[VdЇB& zF>m%Uox2*àkn)=(kpĺƛ4=~ߓʥuyde6BhHɨ[" Іkܥ #&ѝBh'쒶sp-, LrW7Yqbo}<6))Qn(l29XFA1!  RW7*T(_NW'5j;KdhJEP"av38,P~tU8UDo^p-L#y//h orrsk`:6曌C@ΙWX Kx6͋]>}{8H@'V g_yG7VL6j$Бo>oηnBBh(\")8 P㸋;J8Bd<8JAYcK,S.TԒ2Rrl %a;?V}^-+aU6g+1iS;niT6oTTJX=WKbx{$7kX=0? &hF@-JeNܷ; vx峬{]ng[@,xo`/C;0:hJXEMlRoy{~:?_D1 cs @ͼ_?X)Nu%j W)sFC_&lJvOwA=IacԆCJ?bu!D2%8R#Sq8>ؚw^džR50bLRB&F@1} kBwɢ ۀt>V&P]L$!\J0<)ԤK_%Weԙ~StA)_ ^;5EWg/TksoJ]Ϣų˜>7l@ ݒ7܀J91\.^xa9'ֶʧ*#DhʩT뀄/7",fbV/#-YR7VBd`)WElr79zҋޓЀW5ފ;V<{[C*ຖ[ab.KK[QlھYb^\m*"x *^a,)ܒ妁UniJK*ŰS%t,|6tFZ/J. fZ(FBz^C疺aF#{Ar6疂'jQߖE\Pb1Uc;.Z˙+kXk;  ON\fER@4gUJhToPQݩʘ`!q d~#DM 8/i&J9F+({H< 2`≳+<ԂPA-sy9 }mŲ(k i^jiݚZ[c!sB-l)Pޜ)uV=̖Y(jG.PsA_R Ո7B lpsɑr̟:ZY=T}U2$`N~kk5>)+"9Iv6 5H/VR>/(5[,YٶE;Ogͱ:MP)4PBJdڌX9ɃG#YEgr]!VLJㄍuٗ#.9%[[ig؋3p5y5=<FK(ÇSFo^1  `Ch&1 91N-(BʒW/_p+$eig8&a0H?x,~֔<jM6ןRO 6.?ro=!eCz=mMj,2v)QͶpk( k2PwW 6۲P 0 s@+u2Vz&Z']<:D b=@I11FxY$[k4<3{B!,,y&~o' q9b|sKƤ=#Z69IUzYmq=0 Sw?;dfu>7BܼԊ] {cr#LJ 6OBR"j^}h..6 WjhJEq>np 2 m^&]&ȋ7"]YGu$ Mv}sv=hEyTu$Z#czajDE+;Xge:Fq(F'uM! MĕɞEbMoͺ)> PKV?=Ca  k5aߚm`̴g ]ƒƢ)V M ;VEJM1W:8HAzd6 xk8!it˕ aR 1Ѿ͚&Gd2y=  (`^Vδ%ƒ#>8ij]3!0LFf?&^"&""g{{ 3Ǝ TP"$5n,PB)5ɧ25u:TԙsSKN2D cAf]da#ԣZg:58\FnF<8娑bce fI # ##8^bKTOguF %J) WEk_jomBpϐxu5ySůB0/Y*pC,Ml}+8ac{\m0H>3ɭuqM.!ګ]h:y58C ե<)ɆCL໋oy0jCZH,!%N`! 揤|m绶:)+ j2ð:[$+8Pjml+{qj7r>qWF˱+mi0MÈ\ĵz9a]g*|_M,E{Zm tV06}W6Ǹ8yllc3nmڀ`A$` )h^A85>ydIӑh˔wS 9khYO%^_+[|^_l&,"6Z κ;;BM '14h :~?{ :(!۹d,1w)D*^*Q/(Ak<};KK'- =e]ޭ@y0/K0iq*_8t9ǚ4  6/dwvޏ6y߫znOSu|5!a$2S;t> u4=lAIM4+aGԼ; }yWY2y\+c~ wRjpT&{/ə@ȑ%dcd'0]oز^}K nwNB7GY Pfm@aV̍Asʒt_AQ֧/PXX6q۩zS;*ʯDŽ  濳Vph9Iͻw\tMtPv2Z\Ĺ (O܏P`I~RW&G,} o{T3'mv<5uP USӉMsNu+ZkPQqw3=Ja(jX$og |[ͺq Q,=b/zpq~_ eC$""vy.P,tc-ok*GG97\,"8$ AGfNiғ=ު/NԽ`af< ׌tI!k긳)2Y ½/9k 5NP|7Dя[lȈ~&/w{G[Rz9B=N~P"+|/N/땂 GWC /8F3( j0D#W4S|:ofYe.s4H=sr2 ?$T&|s~="J -6K]r%0CGsmǎ7R"N A$d3N,ߊ}{Ka\@aV0QVEEXk i'|zTCGL,4#T )0  5iNf9ǓE.GO@t)%|Z-ǀe5Hg*|4ޯ\f.!"Q{U-u!JZ`}m}ҍ*A.Iea/i:qM%)˻7~ƧB_~)|6Zm[%όk0^hi_=L?DŏE/K_5#A047i pTEKITby3_3 gMmc3([f`I.6)x hJkG7w?iMؑ)M[ -ml=qyi A{ˆuz5;S7CcZʨC" wfi:^ui 6X7yɎO#^pLZ &J.&74F[v7`/ aB*z+ۯDs[=e1*Nu:~KX-rb`.Ld,f!I҇"ʘXg L|u"ᦤ[iUG&vSM3Jq  |2&Bfg[u'\nb)mI&,*^'>׎2_D?)黬YB]8T^b2[oAQtaD\Œ֦}眽a=SHCȅZ9 xT~W ꮍ[VoζZЭ64EyF L8TdJ~bPY>Ȃtfʚ;ˡ_V(זί/ܒ8"P7E@ [ Gݴq&vm,Mr% 7Z_R.'`4xzcN[݈yeXB.x#yQ [3?ܦOm;L Dl7xA|?_ƚM'`A LfU=sK>$lwŨM/*`!ul9H Aϕަt4Xj!Z[$ܟ/gZ>bTM*f>Z-T!c?lD[>4Q~L?\݄ Փa玱g`09/WGOÜQʰF@!_9*nztN mS޿<*]A2"̉=ɴڤ}3p& F, 2ǵ<{+w$O8H8ӡ$b|/$&e@ ~[mJ c[y燒%A\j  kj{lKb$݋OG,߼v!brǑ{Mwq~Ɓ|Mhj|?,dlƩ ISa3u\/LJq~t̉D2#ބ#"`*cʈR*O>Ad<%@j(747>knwCڴBZ/)k̃& a;O^^2&{?7 liL~{a#$Za ۟/VI u"/q__,-Ҁ m@Cmd5okwqtOmحz x[OT}rv_m@DVxcCnҊ_4| +Sj*'ݠgo37Y7{?ݿ`aRBLZb@b3Ք VTݼ#-tr>p3wE_?Fޖ\dq"K˺\Ri\uQRO*P(x҆:OpWEfI}$^Ŗ"0}HK`clؠoqm/_wwFB)>Ղ]:tnf(3E(ett&fV{ yHR\J1[.=3ϙrƝQHb}H]u `^܎=2=3 B=פfgnC:V.F */9 DzVj;y:\}#94p8.McfJ{x:a~ s%)y>,czH5`F')خƺ+(DZvB*#`7o bQN .WT`<l52s&Lw^BҾ[+bvp!zidr!ƶv9$;/ ;J 2TÑk8!Qu;E`&Z0bNd4;W|I)99f/)= iQR]) a5 :u-!-lib`ɀŅ~#󶥓uWnďbuxl|{1s$(:@^Mn}8I7N8TO^"C $2p~_ )`U) 9ݙ[Ƀ 8r&ӧ>8Z?vWYVŧZbǾ٧l0A mQתgN3Ϛ׈5Я=HU\o=N Q啈ЈSbi6X Dj5sh:>~^x}_+!t Ȱ* -5%Kͭc+5 3 KuJ:^Y=# w3g2V*!wk@0\Dn˥_B8|= B,5ɟ*_~>נd2$DakXaw 2+0y*]Yn#ԎYPn 81ǣ6+A߂w`$`yoV? 8̤}+CaĪ.~_crJl3 2iSa_{OቸoDt;< ,Ozmֲ'nݼ%M̓lf;HsA铝V[ҞGr"fn>~||\T[BA"kFGt0Dw~㉫2.);M)slQG : :"(:㖘GF}{vîJu J}]cj,A^~o/dAq#Ɋݒ{CT^ rs,] R DPĻ{#%>3V-`ӂ<ȾFd@dE.Eqn*p\j{zR`Y{bLĊZIT*}IZז#8ob= YnLjٙȰ'Cl[O1TZj|u|?u5DBaˑ9+,5ƓQ@Sm=ާl"x{Ae:l ҙ%k! 'ӑ 03hnym2\v1Ndɋ9*,eLa;Xt؆km5nI{d$ZhTa.F}8fG\~Q`/X[:q78b|EKUdR#Z։fC#-6gwA伝2,TEOarϑA;ec#zc5}ل>7+C;M* P>AkL+ykMBpd?]pێ+_VR;UP2Y͐ihJ{\z}c\ ؊D@("2=B$mI,@/pB(-rZ󇰰Uۛ4?~N4ѱqM)SoE,AVA1ݥDQTť(@וY.@6]h֕ x-%x  WiK_ yn9KQ(-0E7-sQrBW䬦>>&A)uf?'fgו):y4! kD!7Ֆ?,.! }5WĦS=BHyam߮_a#^@sAaj?d8I;o53];uo?W0t%xbJ9"DLdg#cNE`ppd#WUgDvUėzg>{8XMxn l#ݞ|aIX O@!"'8 x7>^\M~Dz~ "HSzr2&06ZċeA#kBdy9y[_fq}3AhHf|<+z'>f ?s9 $!PF\M/n(=& A ?ė X Cʽ|(4agYͷY"aqye@AH)/`T<KmfOIO(B G_dW`]_4pꖴ!EU@ls[]f D~)$pcsqaPebm._)K V۪w}+s~gO:-&T_Q gh%z/\mƳ վL-ݵ:8[]=NJw>-> /H #6h~ alz·1F*@XU$U}5u*E_}˱=}oQ2-aNu4[Ms7@HzBI' wPR!0hL=vH"p>oΝ?1Y%{2Q# VWVn)k a Ug݃bq-B+5s*;'\Q9rd%TlQ7Ko1,W:7iEXT2'  A&n ˫^RH,rDz.ioNy 1q? gt>'m{!ѧe~{?} 8~S!ѭ7VMݮRH*t>L# (( Mխ鯜*v7  ![xEߙEl8Kޯ145~:){AzG nU,!)`tl*>;GIo##/$~%W6RR $dM0} CTU==QQiDp&b)=Yrn?田ϩOddy7X%a"s~'a!"@UQF1Db,F(w=<ݍbtmeQy 3E TWA@&]: VsKNx Sj}jI̅N@a5txV\8}>~=99a-;JFyYp2+q<؁bs@&04bz_ڟtQB1[]T5: K}Rt}>&'1խkpNm~yS8R90hBLMpJ ߾Ӽݯ\և ;D\\kuk.ޑ$&ݰ$UW:)y\DDA^swEmyl( @e$ .{I*O:j?=c1 R,㇉?8Z`>{=g#_e`HL 2I) UDG;v_3, BiXPF|&ow0ca꽗MhXF%HQf1bt{ x9ﰹ)G Iyg|r-Mj$B-F =i"x7$(i>x`'Ej_5T뎊(7dkYZ{&mFuoBZ_<_y1x(j~3 )nuIGm_i+D3Ʒ ):M(\]Y JMnMMv0DD#^5}+ɖg_5Z4d.O~)0i'Z'C#vlʐ({@Rbij\^ԁ6 F8m*N,WěS:3{'Uٌ~VZQx/nJl6G- Tgp$e7AIh;Q9$(""vk:Fz>`/Gp4MA+'rU34mFE{Ѡ|p [s\ĭEO.,=^c_o_iS -DPhays\䷊k 0,} 5fE7ƃ L2GnIH2 *tחS)^IRYdsB[~|J.Kbu\Eө7-ԑX{6e :,kXT$.QHz;DfIQYiiEQͨW'd֫:F^yOUTfo0Ai8n"y!SN[݀T7H< %W!ΛIj]8f5>׭tǫǨ-D}'wɝøZ'uBcS-e<٠&;okmV nk&M5kou똓0=^w?x.=OWh9\VEP/z[JAHABa@ʂ6!f#/klyEx9Gi4To=\J QPRD:% P )m}YH^߶q ]T26 OBr"%"; N}T&XvJAj~=OΕQ*{)n3A2u q "cpe4`'=,6S.Gǃ[wK~8I-)r+?@H#R q3,t{4/w ``瀶mdm :[an>gժ,;lzGfCH{TuJ@Y%%%;?F&EZOЀcZk [YvOy(7+kQe9`i|8:ՉyY~_[~n[{8|c<8dDG,| 2J~י*b{O>0K%ltfý5^a|#ڶoweQrʩһ z! EUQ ;]7]~g=V#,j"eQZ?"iܕ`\st:*N8ory m*qIlL<@Yh¾FƦa#&7NØ?\EP.8Vs㤄coc!_}J`˱ ,ڍ,G%r̄+1w ~3ۧ?SzŠ!OQWZi$ W H !QBwmiCbPmbe1)TMd$-r~W߷8_Z\ڭ6ļH6{Ȇ9l\yE:Gޜ cФ+ӘS'Do}R@=Q;6T8KK]~7]{`R%) ,>)> ݣwf03neW밸*7awKnBb L&J{f:T`M8gDD,hP7=n d3 &To9Zhm"pg:o^Y/MCvK, q4@K!S^_$.g!w!Q dg[5rJfFvv٤ e:&McmUR(ڭj9 vN=}8/rzy  ]2eR#err /¦O|݀9[VbX@$ 08B*3?SJOLkʹ]<QFi],|ćV޽~5 I3 .mh~-y;yw/?ϔlv:@ؠG ^nA$ ;) P$X DtzcvԴCdCZ{z=X'lG⬹ `엢$d&L(X$Q;LƿTܳځn d}ƻH9 M|liվmjf& F(:v`dh IYIQ,SI'/iq0L0Z fU HfH}ofH2|ַw=$nW/bvg[}jb$EMwQhAD$'_Foz`aB%)%z?&+??ގ]~7^ūah>bo{DS  @)(@vZFYX@ʘN `hI-T1895 n f%<(Nnڥ"Hk)-˃AœolEq}BHm@2 Lm|]%B;1N,`Xx}+ ec@HI2LjnF3568?4Y5ps3b'F|!wmnp1gsN u 0=N>#@W%j+AA/.o sÙ@X'$z32]`Ǭ>F|~;k0otFm'{$zEIts`okp-fCx>]&? ALj8_ȽP`9sTK,_6 |y Z{+ +̼3/e=0(D6^*:3̷NˮMf^ nIn{khXx%'8vfo?U9EMKĨ: ƟRBpBG3U4}L$ΟDC1x܃G,JgͳVدyԀ⬝>E{]cȞfw1qiODSyāu}cGJ(O %US87D$m^`׾ϸs 2цG7Iɝl[9>Wpu5,80s~ԧ`;(!\}Y8XDG8R+ 9\ZߓMr2; S4Xϓ|qq@€JAg0K $c6@ 1nѩKPI3lpbUs7,^\cpz%1)T5\j~޷9[ZW+>Q/ԽjDە /dDG _DwTf$>/mV¡vc6.UAsZl\.b q5 ϟ#7a~l&Y %)_0>ZlKwp7>l=I ~&mM\ss3@0y?[F1 6:.Y\kkQTHN [Ƭֱ \Myj 3iT]e¿{:N{| ꒈlU,FD _d'$P 29L41ɳILnҨ/wy[^:{n1}s`,Ou{d~~<=?O?[ڎG}DKɒ/|R<ұ@_Iim JB?0,Rύ47m"Cs/>^^/>?>'!CrMv\éh.T+4fIT|//@ؾf7Vm\[^{UI2M-B #@kZM[{݈*Cc뙡,K΁uK#z;/^)R/T08ըd&IbIM\?}e8+2f<SnHS(`R̅ޛYTLڏ^<|rYoJFIR-m8;>76g}?OuqfdYa̛ d=!XLeJ=&rMd?3Z7$&s%Y mh ~?5R$kapf2"v;6!"7ҟFA΀4ފ!<`\9[&" QRkv*ޫh1~LW5Eu$fdjY)lyP ^-MG8Bh/QĘ7[<@.͚*qV#O{b&@;ؐ8d0shf?@;(UqԳգ= c]CKbzdH͈gVsH!9ÿcH^YRl/`*/d}n'{Tΐ/$6 0>Zt ֋Ŵ׆(,Vi`a <遷n{Z(0}dy׌SyqϬ! C(p{%Z̉MkGClx3/'#'yu:l,U7H[XW8+#2Y^~szѢ3hʮ\W:ǀkC by^BE?kˏIZ`ſl+gr0DByLMG%ޑK$__03|4c=#ІBcQԈEO˝l֏WuVRNA"4,{!q8Jjy_mt'Daӻ慈S,Aoi}">npJfl҄pBkJjԸ Gu%j3^q3MmRFzchQgrw>Bpꁀ9d6k}M:P4on䑵vaA+A pusB2uG642 3n˕~8yǂ1!5 mL$M&(7JWFB@ɼ,Ua ||aʶ/sWg~6trlٷG$8{S2|[d!li rDܻe[S.9sҝg-J:؈U(e{&KW#݀{4@<}lo:JL*갺<כ}Ν9bn0%DD6zE]a@7QijS5ǻd.gNBS1$ij\Dy:Z4$P;Hb'yACw|3qe8p1 3Trq1p |2j0C-yޑ1L0MYT @YfvLyfő4(e 6֌zكQ3G4P٭Q]6 - <ܒfE*o4E׬g&v!x6G}a;;TՉtf,\( qK;O߮ ft3;)|Bʹ"UIzeP)2W<1e,p Ǔ$rSF,˜}}@2 S}{\j6 ǫ|ENIgʧl8ZR-cG7E<{kl vvg"fP}4 LƜ3HN䯹Y؜yGK@W9n; KiyٔmRLQVҰ  "pRAEr5Bs}wjSfQip]k`d+ (=pBUW&?I!..ZLqbR]ӄd)qNx+ D@@DCEcD7.[_zx}"#ADH>Aҕc?Yȸ4MRz{:E7®vH8KH;;NvSG=3 V{86>y s gO=EPW|j kyHp?B:YP̥ ]x: K. s„לRIJE@8ńԩ8Y'!GH6&e:W(ay 1X "O@KeD$l?PfNy{3},iČ{@㟵 zReF7=Q(/|… ?FWN9ŐaņDqJa"/QW~d{=cjOL /75?dUV&d!Geg,rz*MsXB?jdRQ Z΄"O2qUAT{o J$^Wf8vp4M& _z?'g Pzšɳo! ׿&٢gd<Q0o?yc+G:ߒ{wuJ*U{i":3_(!8BH{_T!Ba;Jt7w^moh|Jl?G/~ ( "+@qhe>NNX(InQZ瘰@@+0 *"x:uIoLW .,Dk>;qvŊH~V N>!׊\AC k-|XmL}‘}܂47F/}[sgCb*=DJ˓eDGJC@;Y{j߄XjnPf|GWQK)i+9ZàS;$((롺_펍0􁻞vPK!*S-u{&fi#2s9\r Bϕα$m,^8Myl)$2sVZ&W1X )j&|&ZD?ٹ8';AxRҿ- -W!3|)R= HPC cw>nxմU[<@kk˨Ks\[k* %ANͰy_,maxsT]!Yl9u~˺M铔 7)N67la_Ϻpu,YZ毅WAǽrqP@((8aMG#YVNN9f͜=;OxWocpؙ2l0 @v,,c[#p%A44~tyF He@g^G%xk$+7u=]EmG#+;Z{쿫;*ZvO2Gi@1IOy'_Cf8N"glgxgԐWi-YAIsO] <$ ۧL.wxyp{EDs.B׏p{U2WiVy(.d} 61Vy/6\JɇN1@Eq m?E1&}2`srLڿe/x`E1ЪڽKk: " Uhwo9A>}mޞI# "Y D V_RC& WB}DKOzW麬U pfFs?&sV:&l +?[m_;|$, l0UjuCkN֫a੤o648qInߠSQ̻/k&̞>aίM:U!ͦg_QMVոqu{dZvA_L#Y8D/~OnJ\3OgI7lc״ՐǓ)dȌ #C z.TJ61 ME*TCL;Ж2HF,hگԩr TDB3S(C1}~ffiHQI36%U#c+p< ϳ8(^2vHWegf*|UɃm}A}s/Mm'цlH66u,]clj[/,*a;|.:ݱs?9-GBWauN+݉&E~S8Mxs/pT e'5rqHӒXu|q?0ɯLJ'5q]^#.l['>՚b2.;{nU2Y`P T#@; k.l*œ )ՙ')He@yZǏRӑtB]IzKk1'wSǪ ]C'2)y/OΆnw壗<`CEoQ@]}WOoSn 6Q}DP$8KXpv B k_nRҙb#y>|y\~J.ϷسEp2ffLUd)} 18 u?ޭk.m!YvH; -#{n{ r-QZb; q{eb흲7F3%i8P!h֌Wyz26*'iwC%P'N01!')x9NHEFJT:_hȲBOmԭRzY }PJN@%mH+*tBk(: ^ wxJzi3=#=C(9' Z':$AEZ=#C56g"kDiv!(HCu*>Dm3EL>Q"Y8O=_ ^]:-IvJ IV&e=8MiGCW+\"#i x١mkms eyḳ6Eyȝs4]^L $q_tH( DRJPэ /dz){o\vO,>|ȾṼKt?e94d!S`Z""a~1(O]U-;A &#(lRMΣ pTa9 %lLB%> WXooO|ju Cߩدkw߷$% 'q !.ApJ# [n ܕ/i~U 6OP0[tN'P4StF~EfDEoiwN|'A:~:Df(bxM4{pb0DbYR?:XiNILS-Ir1\R kBo:YӑZYR D_B"`~Og']/&:8+ K~߁f1:/:.u.?*܊H)b b=YjV;T"Rj rwF*AB:ȟi\1%8fs-1i5 ([Da5yeD*'Gxqւ6 FA&hPt [!:XɔZ}}sp3&ZFrNr6oU:?3vQ,sN*\:` (O.WƎ]g[(gMsCs_ !wR Jv̕OF/,)Uf\ʗko'SzNIBPS{D0Z[z jSléƅ$מDDS(uȪI:z.Q~3##kV˸lU Qc%"'b[zPrSs1n`4s/72 N=]7(}5;;8C٥ 5e)6IA 4CyBB&H24pë0c'vl+|F1] SsiTěLXo(dE"\9)ۧy)ў%ٸs@n/@d*^e"2%{1c݈߰U%^YTSJZ dNē".T94$xMœQJj)8n=| xmu%5-'/@hI6Y:)H&VW80̦‘0[sONUPmjYdW*X$ui vk:mM}O[gR/kC^MI> sF=_YȐQ#DkwMj3%يrɞWfԑ jk+JeoymW㿸/'^n9>(ќ+U; g\}Ndfܯ{6̑nb9PiC}e1iEk . ɖv>=֤/;3c}=ٕ槍=*h@2\EuxLy /n(InD-[܌)Nd~\"t3$|U*Y]?Z"@$b, f*Q"F^Lq!)[Q/1_a-X͚a-˫m#jheB62›UhZr>Rƅϳ/MHЭ[{1J%;2ȒN Gmђy-{DQ.%ηY+Hlw|ɰaį>#ofE.ǂs^x4S1v30K]A cPgS.Z' ҧE/!R%9j:+m\L6q(21W=G.?Z ID9,18YRau?L6NQzڱT嚑<TQI—t8QK{)[12B}&uΪq|نi"cb 8;tőWqoVm]cZ,½;M5ۏnf9yt뷔ʞ2C_rA 3(0mj<cq(s?#Yɏ{1_W_&?£T|hFȔҐYlD$]k819bի,8@uggSԜ'jS|1ϗ-\]>//5F@_!RUԜq`:lOM ssL.O;r>u|r{]qYW.L"h?d Aiݡz>%R{e {QbCm83^7o]Ŭ#|'}(j۸w9W`B1HDH5ȁ1A릴mύ@Ew,ȴ&sZ9K426졉9WCaM3=ǁo||O>tjIDՋ@ۗ:ض $)N낝bl2c12%@?{,J%х|̈́AeI $)DD'q<ASYkOh٤wA}0s0ī@N؜XY>g%û}dz%h>j9?2w @0u:mB?01Ҙ f׏3Z [gu(1R\;zW# `͊fC}IJgK5 JR)/%u&vWJI17/'? C1. 0.q@-:KN]@,&QXvFXF!{w\,Y!K7~9BEyR$&{! aw0lA|S>.Y}0H1Y[ZEL1DDQW-_Ye;9mn^ŝ:}o/c?\]3Q%B'-뻧I?@BH0@/\aQ1e2c! I$͆c :5+ӦS ( GQ 372y"F.Ds;K?BbEe'( | Q iB1lcVN0Ea#̱Zi}^`6ޚ{Kn˄@h"1z4GycJtN >BNz_vCl:-E\Gww^mu\gHE=3wAAB)-*{s;zl&to:ubO] .elJ&MtPz*tZfF+DAJfK5 1>ם){ L@q? &"kȪ+4ˇ;SÉQìt2kZOH lPтϝʠaYF2L b$g3 :z'd1;$kqb'Qb ׃ݵw:G$LAܲV C-bC!*0%  HQ&6-` DDڃ@O"Ԁ$ :)/:+q (Nf#XkkS ^(XFj+D2H؋`sm[ZwN jn42MԮ);Fʦ@qD8Fδ:)eNFr@Da1IC$#4ɐ ٶ2Z/ΝެĐI !L~"vo( dINEu-=X׮gW-e} C\R̋]݉ٺ`Լ x7Y{<% eLmZ\-댵jfg͊"%Eyݤ۽J6׫}8U:t ss!Þ8ajq$9Pq?uOMy3g\VC*30z4}?$Lɞa]EM)BGQD2ݬI'F={L>vRnɟq~&ښA/D<66Dy H)Wp6`50^2yWf0E7"#$$ 0Bm&lHz:ƒX  1>B f։͜$& Kl74]x9+I|떑Zc('ڤ5'wi&AѺ:ףipcE4vrK© 7&.X9$'D$3,u).͘py̼o7vD@Y*נA̶ c\&FOߛ"5Lٮ{p[#/0D#1V+9@ugw&x=PM*d켴A644.I r"g"'f$ L|ӄCw`NIcd XQ`I(şB{G N @<9o 00Q;TE|79Tă GEݤDz3r696}yt;r]^b{7Ðz_}OUzաC1@q3UgSYZ+χ{Cw|@f ʖ1zMr4&LgV88 $3gp&@ a]P Z$[fV`xo<;}{׼ -~ƬvO_QgRa (ڡ-?b^{OS?g̯ztxD~j#%=1AjyY;;wrDzO|7xҢ6`SǗr搀>B?o_u?mj-F' 5 jy_WœJR!4I>_17 o2GpNq9z<Cc,8x7/r4||jHIv2nkyÁt(*bQ#\ȴ-0=4&cna=\۾:?왚nr%K͟h~V!\u|Qhb"/pĈM@XR)ɘ6^d`n|UJ籰ӊK3l[ YgbiR3Ts`|G p&c(8-: ^~u7 ɥ5W_tb BJa qxfwF 4 2sFK#a~7uF\{&_3Xz^R} ZѤ?2 [ ($Gڢ 6`!y,+\LSW7'[U:.?5޿v7mmUgN{A/b| Zb<0%R8`^=Uj+{v~J<"ٖ56 IFՙu & i%k{.nvGܞ+34Dw[19LhrK?.;6asw+~rX%U[|6_4Ge~>GFh=2D$#TAA@ ķ] h:dV?I'')93ۿ۔?bv@pKH8vPqI}~c=o5UZ5j0E+> qD %%- c8Oo)-y7.z\UUIRO+ԓ}եGw~FY܃_[7o+յ/$ƣ_>t3Q",:J l鑱Pf`EM:Bvq)XQK+es`xDVo;_7s+z>9g4VN"͎oݧ/-][g282Rf(n p'R@Hq("~d8S]@@B\~l}"Dg\_8"b_6u˶/ټ+֕@'0YҧOoʵl-h+qg7*>ƒ;Cy۹_b >`kmVtu~T>:H<+_~* k?Q~_o-P94e;=7ޟua$3:?!dd:!Ͳm [ВLG~ٌ)z"#1ޣ >Q~;!~&{r O,L'I0ji'/.)2HFx]Ɠ/5T^(ϴ1r7|& \OU-G/Nf ~efc@c9[,H l[mZw]YmMxAvH"ƭZfL,U5wb3;t>G_c߮~oWhަeZc7auz_kO Sw;U"6wgd;:#tQ_E> ma󘙞J|~F]+mg`W=>)-f;8?_aRRo)O2K3ɒ_a `T9µ~/uUW,UqI{paVB !{V?fuK+.Yp?(t(GRݩ,x2CcYƿ搐_?}UĿRCv,CZPr_XpEaͭ|}/F~4۝K\:q>L]ޭc7+ 17@g5Z1UYmN&5Tfqb$@ͲO3MON\6L)^h"ݣtG>ḿkw[?~6j X1 oʝ"?5ޭ uM]?V{2wXVAʉ'ϑ=}XlZJ|DAw.s2fQAz'%y &)r87 /Q3 7ѕ%L"FE(Av#w&:oыE(&B"+M#u4!Xo$_sr Z`Q$-pv` 5 Kl5塾ji)R5dOb֞Y<NǍUF9-k<5ѻf"G"=.Z$C&تl(."e [S`6n7<-G BDu -Xdbd{^FxmR] iU߀G,/Z 6`_efZݣzނQ⺸zLs;\=˷X `b Ut 4BP "LP I$Ā)}!ahyQr(z? kgF<IӔ:+ sEÁջBw ^X moR`*XJaC4Ib=Jꃳ*"˳6? f:vXb%87:3|Zf)JQˎba8m13_BRYrCɈW`w*]U焉sb*Qar!dQ)/e)%cL)G ӋtzIV-Lz*&•YW핛$+j qnmMIģ`+GQ%`upZ֎ \9dͷ:LR TE_OY[*𩮄֬&{6D߰^$y Re251cH.'jLؐM."^w"0|4C UTby] չ+3CѴtvrsE~g.Ú+qyLcM """,6W9zU-ѹ.TATPyQ1-~TI ._Y]w~ԘfDwh0WvVBư% A'^1ja7Zroo&K(pexԐ[9hdc6<L}%[a yvOINouE?\ὴɐeLBvM #~$#DBF&u(7fy'av,^s Mb;YQK|%Yz F*. rBd&sM`%CAZ{6\LP~m[ k>OϑG܇eA.dcor B[m a0j55AF1C7 5S D02lQ5! ospvC8iB:+63 gCOeG>̊}>r(sO{5nGJ5+DYU\dY!a1$"'/\9&~օB_5ʇv+,V-VJ)ddZl2N&$5OW2& I9ǭƯRt+Wk+ݼOH95²u!ݭHU+z+6kQmѧ}we(GMIl'Mq'}fBN=bZfBD6SlT/HC9 T?<2[8#0j%rJt$[FBL!>"rčn 3zWGO_PKZ5>ޗPV|30p{L)I)#A@Y9-9[싢g]2$@jɸ$ nU4vөS\5%4tiYq_`y,$> Y LynNjmL2Q4n {3!E_ɖ(ao' iXK]TɭF蓾[r=-5r1ɿ=0.Iv$|+]u7A/]i|F03 Ж/MAU(/iƒ*=)clzaRƖ, lQ$TbOtER]|;xX 7oGs'h2&O+%|xh^I/^g2jiΛpXm}r2qABuf-V:[շ .g6h<*N-Ђe-9yse R;3-A;.@oII\m?&,CiILL8}/uw%5 7*v>Z/Oe@ɢc6Tr P>+c->(Dk8r⑺ľ*ݼ l@RL]ʐU,Z DM)lo\ObRWٻNNc9۝QSBY,:&:Za1:/1\amÔʼ_-*.کN=d˸W?G& DK<&iK94ڰs gfɰ\v8z}'*H_7LÁZZp:9b+ `_AIh1NOK|JG=;ƲUI/*N Y(foFuG^-e;-JI,V1"_Y`DӔ_+6NO}vf&v "Z^[qht۳v穕ۍwt5k6(;gaɗ7m~ * ,AsqWg K7ᑃa7L4@BH 3f"m?{obZ* wf5,0X SR(#QAX 55(UEo; F cyւu 8 rdxp\Itehnx"Yy`&A )BmKp(SYq?RmEM71 ,m_y3K|@"Ӑtn;C]N10}B@EΔGmG4:=ٻʾ󧮝%Ӧ|x3> h$c X08ʈi SR ik+}dI<46YhšĭnϹ {i*TKj)P Y4c{R<[E[X/3 - \u!5kZle#۠cTnٹ[-hpH;DZu჆s;ʗjb#pTg۱&3Ff&߂^F[-$%X}zPB [f ԲMRM7IK,ϲj/~G/U)z^ӢzvȺH@xm^1A5ro)#%[89}'ز8rӾ:sMPtAbV=0X͋sðu|!%\Pٍd \͋m4.7_0cX.CK6l p f1Ŧ1huWȻ M#:qRm7UglՍ͟7' Qp*~MP&'"A;"&..dfkMiݳO.d0eEY*GrE27fc"2ŌR0ǤŋNXi,0`aEBz yZ?/SmX@ LɱЃ fDCB4S6H۔Y׮MSۼPB,BSj&U/"J8D#{vnnJ|6Aniq Eyn3 *V"rvQ;C`У9$ޡIyrl;x@ylg%nusz`ѽrN@H6Zkcryf4㐃ku?=BU?G"`1Oq9qt]ǎC]'1bR5rǤ &y]ppan8RwgMqi(ւAD`HˣsmN (E;kjozd5ehaWf1AVNp8`W͟t"O^.#A 3ԺlMYhAb6Td$6Vګ!q II<3LgU8$Dd"ri9U8m2ݻ37 K!e3,nBȨr&' ;qۓkիQekxk,q,cQk~wOG0V qֆh)"i)@p{΁t`)~iZjP/Є "Ǧ*s=;gum}3'uʆR_'Eӻj<6\D|_ʅ(Pp FWjCqqN:6>*0ΘQ0 Bx(gyϦ/o[Xdy1;qNw9n~.=9յNi3yCĿIm"!y{JТL߈B#~HK zy:#iF[M+Ԡj֙Y9=y0/u%8uX @֦Y:8[+Sqh:IBH@bҹ/]t oHC+7}9;q?_e=ή'r4m/cDr6: NUq*뼞<3B _A2; "Si&v4k9(+Dm|RG~8EkIQ1D{\9M\oǸsMy܋2.k `+ڜh3e3\hd} CP -w#Co9ݨR~](^w6E)_w0 _"(9#=JZ fD#pbF2R:(D@0mDap #\orQ(duU9V=!I1GQ9UD% j#Q'9t*l,V_e:Bō3a,/aK"zL,ɒ9sH5i3ׯ>x*v`@$D(\S̞DC reReO{EϚyW3H'Ψyؑcn'xNI l 8usk)7o2L $ 1?-ף}d\w0_zjrRc=N%?kݙįB47:҂D<,:0Zi.nqC_|8 ` d<1I1G9AR03D_9qr_P#?d…zH8ɞEh@H͵<O$sS&>{r䓐JT|A]K`h$B`9_ԇݣӞ><..3fetƎ_GNXc7MQdQgttr<5.~  e̠)s[`%B+DʒIWW^&?"8?wϩ?qmP ge"F?=?6"ARnNלC##7w~V]T#?[Cd3fOB9ATŗz;[TXE"H~י<}ۮ6t~Vo/}\{?[3  4:]OI5;gu E)E^jבbL\BPD9/(w  "X@(?MrG}"Qđ`H ۜCN&"Ͷժ;凑z?ֳ4NM#FIbo! tCDj79 Auq91 1u'w2E"u C}/\3G[?#->_s+k@5"t}vw}[X a1~9SV'9o;Rptrَ֟jZ!528iqc S$h0gs`3W/sOStmm.4Wu1_E/ISߜয়X7tM8cdG@С.{a/$6R߮ᷢk]GH@#Qڬ QO&s?+CR Zh{3N 4\(v9 "uJnsޥ?iv Bu8ZWhdHE#zH"($dkkUncWk+ʹӛ~pq, ~_V9;KMk0XM<}ee41f^5& (k γH=`tBCG+:.XcHQR&!8 zw㶢p^F9-55wN00@6i[; 2%R z Su\Of$~3`5k+9DFH*bs7s3w40MD0a>pMÔ6@l]n? zuqm- I+ϝ݅k$TjFb!8we;g $+ ,gsGdy^_nk>T{J heUsj ИRY\>q&KyJh<8^ %0rL(#Zνxn{kDm߆emp|ԛe*Lʌ+N)QAՖ58gǗj^ج)=gǙ5m/upz[e1vm, ko "Ͳkd.$p 7y]6kwJK5+l >/O'nW.Bgezwq^%wIaQBH'ǴZX)Qdh<2)]Ƀ[P&C%+SQLv=&s7rqWb*9#A/behN8{MTVq ֲ no mkwD_WZ30 I4m_.YWſaʸbK; /HZ:Z >jv{<9Vԑ2 ;eiw'HdفO(ex*!(ChD"B_~۹oNk{_]kE3Hy [GA )7fs=F,[v2 +dpw[YGQAƊzn䗷F1.'ɵr0`Ymj),14V8i8Qz 1v8ueо=Gʿ'eEzGwfgUNaASY)\8c/Ǣ*mS} su/~O kAA9^[|c6dߍ7̓uޗ4TYU\c x<Z٤ %;f4.+GJ4f@gcd3*T(.jgq5z_B/\RKcdf* đ4 utOz?2S 'х1t=KaieasΣ-Fϑ7?=(2ތ ۔pJ2غtLqcZ*vg 6T eA8IJT2sp9/uA2c>s Ji$4&QAAoy%b(D@ƽb9S ~zCyo{1[ND`8{w]OnI砉oߓ6/E_䇌y8NǷ#!Lrq`4&AuyNB60mKJx}l:d/t~2٘R݆v/֟k'/þ'8YonD1}J0A@_>\]3|>659>yJx3}8V^c5g߻>M7W9mԳwׇ|w[Y|;EX826[uݦDErE-Ik ѐ-bH(bB'"rbÏcZu2l|+e|6S)pP!?z wvac_dRia NdVqi l|$.0ֹixWVM8N~_mպWJ4-:\ay>l=̇Wum/ moO%CR:?j5vgؤmxiOdL:vv G/m+nKUb|C 8ck!<~ N%!.j(xCŎmQ\fz[p[N&JUUD)=U9:M̞ y# X4R:vVN Aٕ}KTk{oY/uԽqGlzk0l3AOD>kÒ=.}.۪Nʍt:[|Z*5>G6ݱ"1SH4Ϸ̧ic #!v{c)Yq|!#Š}9ꥁ!P pvx[n99>rΜN=dSm?v~$@2|]+tnVz w?9Oⷭff}0ZvwӔ}.8_Z?+UjKroދL|0cw'ߌt{M￯Wҧu{6OQ@3YHjr2r;j_RR=M[皌^rgtq"f.u׽vȴoy[~*LOvmmn9 _aJeRzLDaٷ,\FzndxSZ54:G^z0F?w\j?EO@H#c;(M/?L|lX&-CQhw"gɒuR+!1 mO$aTba,҆ibI# I?q F%xvxm9fYpy ,B9/ӳdndAzk&.-y 0Կbj{ٱ'!'f^P u!@';vһIg vD X51!^=ymkqg7{n.tKTR\<)i'wJ$bpĦ& :? xA,jU9+@u~V v_m#r4yt;,0J튕Cet.R GT+q8|sI^(1qV_ ?,w6ꪏ)qP[,j 2nf䣝B-iK&[fܰ6pc_Pxf!e/(Lj[y; 0m2BԱPdZ۹t)QVJzD iXIg1OFYIxMRN#plE[9Tdq8 #=(ɭ)7g30[{ 3eEo^^i{'Z[KzgAx@7lӠ+QThEDO sw-Wq','{'Ҫ0(MtQA=&0%Ͼz n)n5LjOj~CmmY1k6zfڸZ U$(U%R$~\@dS#YhQ..P Sǧ$sOԕZur ^)L>ZR^}JeR(ש e1DK.|ëYniJexF"c:鯱qȰeӥ5mO||"2pb;SC[ly= t,SǠR=UW&*K5 ˃8Yٟ],k :S~͙oz,G .'>,VͲm`N,ҧKpq(엘TmWf>snHzaB -iydxfhۉ7U\ȶkri3S%"N w Z&f.^?!~)Q[ no#ڬla7'QCp37S'꬜>3Wg$Çsً'[٥v_Ԏ>>C- w()Z!Gs!0x?~Κp8J)S,R?Wb`O=`\dJ@yw62^Ӎ?Di}?H%e"/P^/+O$WYFW}IX̮6GAgt PWb^C8-½ %;kFJj1bO“tZúwIkQ%Wה ?t\r7q8n2Eˎ[w 6]I'Ċǹ Dryzһ>dhtxl1X% K&HlSiItE-hc zVZn㜺(R'ZQN#3 Z).߳{z r5尜f7޶mKViW,{J::)!e]!lI޶یDdk'nҊ<`4iĠvrQՔakmn,vX=ar4(Ep bɝD8`">nLV2"těl%(5jˮ,ϼh{Xb+Q\LIU ȫ%hqJZ:tG6$nEFC$'&Xgatگmѓ@̦5/nxC=܊6KcqӪ?8ed11%$fq}cg:ipMUhW\R"s5˕m=AkCQG_"ɺot{(*m(Wu&TFݐtsUwWj;9*-_7yB z8 y)~ 4Ge~c|OI lGz)ZpJ76+҉AaF{\q Qb]ߏA8`4ܤqk^ TWL_NۈGjU6;X6d z{1x]d7/Y96s8CvjIL J3a8Fuʞ{ko^H8*Zf|*MC9@Y]6pzLE;f ~G9 rj0 ZL,АL\s1aeÿ,Jnċ"3ެ+v'>+b nPNCj 0n ȶ(ݬ?K(ln|rsZ=PYZe:6^=^)G4@nl$$ Y3gYfqZXI&(:D4АZ45bT/8n:9Gcȗo#m&85V:Z&3-MwTanZ2.Hxo9Tիcan֌; Fhu|:5O1INQRZeI@)=  ̂~eݛbµ휛vƆl;PGw"!'&/f?,#_gmT˕҉úYy_8]cBS[Qj>-.㵏.MʬhieJңDN1= @c&;3lhp('A$xzzSۃ\J8.{wEPܦ#Ϛ Bfxovc?\}퇚}O5uڼͮ=[pE rO.Qۣ*pT+L~_&mvՊG' k&T,.ԝ~jwrˎj-In,Zq8! ϭ-fZ/1%>mLAG@ҁʈBH÷&鰣ƓG ~5ߕ~uZ{'rY ^;ᏙnҦe(~eo*Һ57X'V1܉lo\|"%t%mG_{K9GH{n%y8h4"j͵I /1̭QpEy4C#F1ce[triAg,έUMoT>v3QLwc GVƁҍyf'ǜ56/^N{)66/7oa+ +jbTFzZ 2cHDok(Ô_7w8ٳWFe ϲS({ZY,Lyo haEڳams*ɘA)'K^ ueܓr#fwQx Ju@<~|A'GŲa<$=hWwކ8g<1bQgQזnCۇvBS2N3 H I:]_#CAaAV}Fhdl0Y}S" w_8;lg`)2!r];up*<" Y$ֶq6䉅Fi@A xSڍ2|ZY28pKD!O@QzA4ք:m>dDmo`x̎%ݐB,]'s{\c1s[0N Nf##uH b/vK(㓑*RE1JS ާzZ4?aQ4 "5z[ %p[N_PU.baMj'-AptB#X!d{⸂C+}2qSXKCV% c,<鐺gd2AS*\L!.Fkl੮> qRE@K \qu`yu5Bjn&Xd 1Vu\YYMW,fPPIn]577jTlj ?/.)OY+ vra r6ف'%:,[?M̙qFd)/PY*F8~ygt|Y>a{{mcYPta1aUD| 78Nn5?Ғ~u>}MU&;CqK(L ,E7IWbpq@j9HvyBk- FХ-G tB́"Y.6 %ѯhWeJvւD?rUP0RRH^9N+%~c&V\:o+~gyRHʻg*bjrICM h+SFK4v5貟'W'gj,,A /݂Q\} W7Kx"`k`}GUtͦ?5EzJ^dJw([&2a>w Qhr5I9??%, lwTGN8(FHZQ58 ;iÙ,I]nG0A'h(djV?BCDEP'GuztsO$1`%^]׬HI'39p!Mwr{hoW\Lk_}*,F[!YFYRagZos!t|ahy#mHW{31}+;S"X,1|Ŏ0ö4iT=f;\ҥΆQX$#Kw  uԈ/,p˗o -lY/ U2ٮBk$.h$_ԝU~g{|~yl?yq\ӀKw\l3USBۧ\j/E60%7>Cמg>߯Fްau* QxB"Tﴰqv;e8/ R9zD:E~ M`oU,"w0fDĉčJQz7: XTU>EUSgqBC Dp( lDgRTp翬aShAhvj'D-&ͨU^#aֹJ=MגY>jھqbp:)oX5 71yh+AA'NQ8% C沉Z#8OPThZwMo)Mo?lzM/+YC=p&ζskWƾ'n{Ct<_sK/84'}3%JqXJ:rϒȷ 3gٙY_C<ީ OdܷR>ZEӍ\hOeq{£ھHuaszTÊ O)%"&mPh|]c('H"{S <ԏoTWt"S)* Lv.6GP. zdxP)aJ'u^>17vJzhr41W4\nCLl&7?9|5;NߴmOǓ?{gC IHdQ`,R BAI(ET ",PQI }ס]| %no,?Q8 gl왽V;FVl 7E"f [4|b/$gϷ2dMV 늺m}/uN Q;˼ۘeVS&7[,CzunV_ϸl:+~z/y}zU{o[cXu<.ٶCJONݥn>OTDzۘ \UvOnoAn YP5$ Gk5m7Z[CF c`t qP@8LʷBV4#{NK~lTk2K)ʞFdC`)\~t1(b.fs?rX3ucϯόד=ssËALdwAs"GV \?/OXy9sVN{s=5n^L7Ԛ $z}E 4*'*Ѱoܶ2C#`>btjxҭӭ۳{҉{#! ,X@P$RBR :6RB; SjRHH ( ,d@"A@(9^gm<ûI>]4CپYVBqʛ.Rٖ 6 zg2=]*Gd :XOnN:\&/|+}Gڥ2Zrs_s>lk.a+/%Q84W"@glsyhJ+10ZR[6;JخL*(Vkwalvb1lP]ZqJa7tk1/vn],@*T;ΓSxl< ggu;c5ﳨ^j)"2"}{C~O =2BC|%``n("K. zG[o0&;a2sh a,ZCl9Ztٱ-d .6"]:JFʒIQa!|A^R S( #:g5v]%׊]:% e\l)}f:Y_=!>m6sjDLoKÞZuSqY .qиS:mkv9*f6J,C)ӗ32ō!c&,{Rߏ>/lmtg2@dynM8VێWPR(B ^72)[1=S8?`:^!NWWyހ~Q\2A\H\js6,Ͻ-\|q~l/Y:ed<*%"@>TO2BE9D`ߛrٿr^3rަh7.lr)|g 7~;1>qD%tٶ /{b?#<ϧiYkw0mstL@u1rH=ϣϘqi r*%>-*G%7IK?p<26߯'Yf0y{<`hp?nIy`>C>nxg^t/=<}zjz`NބcO'o 수sUMXG9j=N[so6?6sNNu,ﭾ g2F,W7K~KnTʊ,mFI9ԟSdSE}<3dؘZoszb"3@40AYTm/s5cv3(9u%:m<mah^jU磫,J4Z[ mxRD oPD7TK"蹤UG8 ugeqhʧ$͢Aՙ abck?j:|uoj8_+?nM!'iW{)n3AB-i-p3_׵kX2_=P?п[μCP/!Dgh,z6R2 o&f](]Jc%ѻkTw絣_O|{l)} {v\H@g ^oX.(vJXOo!JiG~(7c7QHAkim+[iVv4;^+$_ _lŬߛgSzȤKQ.~*ME˘WP$ʫ'x_:/֢@D}dO斘@ȔDPRGp];%#T7H{Jvrk?eOV|[~7]^_2*=t'T`:^psY$MJ rIē.q frəA'y㋽)2xxMu'2f I[n w'7793hЛ5#~>E+JVRӆdC@i j8`"@e}ʲ%R!LH6j7;6ϴ{k'c oNINd*.ylxR{YZgh \\rhqŌa@.8Lt5za+`-{OLwXG:"Z/~$%.;YWkUU4~^G݅x1tsqa<8Yo롓o!)6_O3/ev۶fww>Y^%! &CҤ4er\$ PxfqU/Tt\_:ị́bLs;lņ~[X/f#6S˞zOTz ň>^A{ OezlkηufOxl`+OH3Ůl_VH?h~_}GҶM(rHY9Æ~n^+޾Ծ1-DR\ޘVAÍL[c#U*2#n } J՛V$UkĭvJg)CE92nYvT$YkNǵ"J\[=+Gғ%svwrE-BգPMk븿'}[%wí+nɏoy9ͪ+ll:4w%,Mږs!%0ڝ)G V+R鶴SȁG$՗HBYk.`Mad.w ˟ӆi`750XjifͫnwqwJu׼ V=~u_?:"IaoRaf7ZE)(0BE!27 OI&;KAߎҾUbcrQ$1@/jRXP=Qh2n3-g'o@< i7 ꤭QV˦pt~<'^hK|Ya ӅJm:ő Ю01uj\};2ԛZ<,00UH8; qmoB샃l+*l TB8b@Η*za&{h0ٕɰRIPҴxμ4O%כݯHʂE7Ņִ*oPۮO-m3~b04EsDK<[8MBUrFЭ:Q j=!u8ޥkdyfj9%mb!֭Σ]UJ${^ y([ Io|>. dÜm7IT>/U]#i[{9׬'ݜ. ߂l'lD%gB*3X$ \)m>M*Dϭy`S4X" J JUG:.jHJѵCr<='OA;*. 2-!Y|3gӓiy;Κf-gsV6R{Ǥ]*sG}~﹕+)$Q lNPy_> i@7mA($Ǟγ_uu҉V8#)Tr*koP #q.?:f ?j渻Ĉ !'v3k2X;5 Y$ I,`_.$+oּut;XC!<gK~ =+ 笤2\(s&apdN.Ǥ[VDLB%ӱ:TmKOc,Wi+gWq:ϕpG 'S;ahSp_#BR{`|!`<}q4S V~+h*Ȇx-}ϛM *达~] yhnU7i|h"pwbZu虜{}+hر 4wᴥ\ؑnx ]9P~_asK9>\ w|љ{'KϚyƯ:%Oz簂LXt3 /ӡjh@Foh;:a{CZ 8!;)p 5Ț> G ~tdNup.J۽͒.h8LVnxK cxo7\.d::4|'F'+g5yS8b*%C{^Z;U~I^4&nv^rOĭ.*[Y\Ij> E\^V-+{ށq/vjV r>&ߙ HS>U=Wļ_EF~e'`0 q{5 ?[gcƎְs=,=)U|J@\J@)=ŨL]_f8YLwߝq{$,l˦x0qs$HNH2/@$ uL7d~Eݥܟv7 m`N3ze \#75"< vƜo3=Muׂ!Yzm1X ~o7aZ!<4XzҫI퇔 /f  %fh+EIY{5S&kBh=y"'pyft޳HmxJu&`?Si#.gy3?_j]=[hy̾L( 2^ F]eTo=zZHп{mZlݾZp0 m7yVF&I0R_+G 91E Mw'q &:Y"4=.v'45Կ[a~~%[}>#<[x7\򳚎q-~ [?Xk5k\KuRQP[ ?5b@@g[Cȸy\2:nd4R?KKCqD϶ƣ9i1n=IGXzu1Uuχp\v爰ep7סw GfjCc1ߑ0c1HAo'/{d,u 0cGȔd(4/-_HX1b ÉX"vK(đg qiCRRq+JV \uNډs__Ifu>,D2Xnw߰۽|z? p/ Z )PF^j+|ƁeޕjYByzA`MK|*c1{57Gsֹ_u 1.i~/$F5jpkUOr5X4bK̵9?l tYI rT헓*>j&"HDBimTa=;FaNÔ%Q #@:k#\#;?\[ >|LN._0,0$Nͳ_g)\sC!owH{ZH%qmUZX').|H{ ^;W^k`ٕ ʝ޿0`pW z0DYD&J%c0T;J}u^?vL.4ݏƬĞ9v9H%֨q4gH:GՐQnザ@X$ J0Lӝh6q⋗9 !k+<&QӠ5Qԍ9sRO7QZjZS)[PK*AV9.&@J<9IRW7RklPW52|;iZMXJLnO_o}~F,3W5&at?a;Ru =췴l?ʩ4j5q }?ɤhO;{]xϛ }a|C+ j&7`J3vn/4שsr_nk~VŰ0Y @C4!8(6}IVXt5Pbh7%bHN,u'2Dp02pvG bl*tkڑVWgܿѤttr.nŽ=%dDD?ʾkL]1DN&9ZiF;] ޿;ܚy|&7NC{3m݄KOg#y>q3sUwo6hdjg}W)RK{KnKݹfCW[^/xā}׫mЩJjM5Z؏kRؘʃs&W2+ӕ鷡w8S]:| 6V§O(^ܼRY kTۢ\Of9cH3k8؏;--p[U54nhW/,_ܯJY56;DS4h QȮ9Fwaj*7?KW1[kwl-8?; &r[ F_B*ˢ<Ӗdm247><a7lmjtD0P3к?Hp|@)z[s/4AxN:#͛kv3>uHdֆx{Fwz{fxڃa܂K+[( _l7'44 iHBn%2[QQX:mŚ1EM~ ʅR1:Uq=fڞ:+'++ʮu"`i9I7Yfn8b5d9՝<ٲehU`i, Wh2{McLtfLx],n[ǺͨyzA-:ujca(,zQA51\BIջv^1.ܨu_Ra8 nُ*O>ׯwJ 0.Lr)0jk@~ =ʄ /mL+ PudɕϪuE_ðJ5YPty2U8vՠ"g,N ʵ6$ڟ *bȬLAwdA`g"ϝ7w fމo]5GK%ATpWl(c4脁p%DLizcq{i'vt43MAJ!(B͸Bh.ao34=Kquy-:AMY߯s&Y a>ez FE3؇=_a73a罩MFgۉ ~cMywYܮcSjfT6qwۆP󗻞6-#  eIlhD:P>MR %.a;jZLP [Lrsûgv 9wjbq^\ 3&w@PqaW0 iej쎀C!eRN؉)_ՃStSd AnVSKU %i^AS5i5Q oYD }M2?> ^[1ɓ%M؇~ \ ^eLT"+k~ ү7˪~^l_WѴ-dz^co:CS@Zk?~o7gxvvk3:dpݫvHoo fOWsUKK>#[8oEvu;ls/Wـx PG& "/?~w=.3N_?..GSr~gv9|:tm Ji&]y'tnDo%W#_s-)H{_wjvy,BDI)^nmYlmrFV3uIl> VW<2jk?&fcDǣWKf=#tqɽئʃ J{47y6aNj}s?w<#PBP5oL`_y3o\n8uwNgKꫩ =Y?ˏMlg rN+*Qɿ;|~_17gQyU&urٶ~563\)~:|9Oݎ|O䌌tjMtshz7TU"e3&)n=[щbn>ݮgzj.SEc?A%8 Ry'{\*ɵ.D8OttaQ/ބbRK1k~bDLq|ܞ9pAzPBYt$Ho]GU]Ij{-躏pn^tקxvbj>p1I`0| n=O}~$| Tg:^~tiNGws\ 2zxWk>!a< &|2sSw 'pA.5z|OC8!:t z*ھ3veZ,}6Q|~Sjo&,`ZuGr"?~ޙϫ) N=1kBIO@,q~Nx&MNU36n=%}R׹}=56]Lw_3Inۛ;ˤϯBeJdѕh>!:I^Z *Zrmda?D"ۑ6nǶQ<~RX 'Ĥ[cr}=>b-o iAI +ߑ?Iځ;yaܚ]p /QߎL;ޭ˹dJ'|I{͝7Ӷ lgx^v'_TO zx"Jv,|mŎfnsxetz<T/a`^)>cˠ chpɞ,Y6^ޠ\5@oL0ųOB:C:PMATr*KL&sce$9S/ߊxfowRRU-ujʿk*hh'F4WF/vf'-bkEN-:Ρ7S!l_ּZ:ҿPOi)g/ZV4[J>ǟ[[keYzNނl*ЊoGwc 'wWgL*{<!5˶~TIJ|kBVh|0[׿˕VSk\mXJm9cbřg'vg]jo}Fu9=xH:f][2se9־] y4o;|F֖2BlEEH-z{>~BEm:s!m<)s=JC0X|qroy%4m#L]O0?&zfIv;_ >{$5qĽq0TF ʸAlCp!BX }% 0_v5~)'>u] )i[YW$v/^D< r[54Ҁf`w~:i.T4Ls@ `" mZZQS^wnbP#puq=z$ 9cUG3 ?3 2ւI@5R==ÿ6!_qXiDCvybXM"eIs-\e| lB" "r&Մn[PvQdp<{JJZģ3nl Ƙ,H4DI&A Цז/ `$|'s00 -OxۨxF'KgE]ohPagSZwhvYVZlg  d6bTµ)B, aEՁyKK3.FcY @fMkmL-6*s50FPZP? Kll6@Zلe0B"" [f sv\*\ev#  +"@U|=FW T`1>qdE5fHږI zF 2!Ym9ҭ-5>NB&@gHv hA$Y u[+ߋ]R5 "<1Jphxf"W^kuAXE LR:KJȂHJ`YJ{PRы@t}uAdՍE}ȅ@8 nxFd,E'gR#Sze4%"8ߤývmx٩ R4d(5ŖWfC X&X-TݢLK5%km#/kXֶaAhbRVYn݌Lh0#hʄ 1pk:d ')j1=J+f˲5Z@B79¨)H9"KBFY/86dic\EF{$qŢP;+3 ʀȃ'\2\Aclg0z^[6.{Zmkj3EmĊ5Tp"Z=S !?\59DNIȏ>ʩձ$nI &*1;R(dKd#x1 Č`f@\/Nc 2an*:,@gSZg`}8HN3_dQGg1NPhE閵5ŋ̄ĩR}cu_4WNuPE#yHӭ%fÚ lSsŭIQ'צjx j9A햌df L%2pi YoL9ʘb)mG.;pk*XmxܩXd8qd^Ibc!0m,/ פDL#uK]fI +`1  Y筐Q ImrQbk!jx=p fVTF+;f%qZf2 GQQ mvB- fy45t\ {V]\ǔ?.2B2{ Wo+_@ՌG7\=<7\ S)>WJ)کY@n(}vy6|$]ieDZ21X{+c#:-V 7`X]C(m12WʲV EelJi E|zqҭn $WΞDP=q|1/(gkN*Uq۴ Xi[;YU&~ )SU0Vaů7iaY Mh|R5If BErh^,a`l9" PX"Q/Mϗп(4N7z%S \3ϣfT"%x/ {vZ8ʧUOhcQ@cQ:bJˈ<( )/Y<$,9׌1%J:b{";.dcxɀګh{zpr+ⵇ 5ow澸3mcu[._= UY!w@F, gYU H\tX#$;#!f egYIحd; *ۭ|j9YW(*}d,IQM?Oj: 2aHDY3/%ŁS*S,V&NLg᭒ϹGpp\rt{ _)bZgAba9:w{$S_:v?߰_p:{4ԣ=~y{{:H{G%}kbtrur﹎g\NfA*NzaV*͵O䆩yu;@?cBR0ʣAgIg;JG/4_hYr՘G1>s=?~U#WuG~҇&M%f+؞vS4O"uײַK㝵F 8k5pԵEpS;Rҧ>Xͅ&΍Zޒ('No=<a&p>.&8Tz`e:;`^ڳhjﶛUg-_1D#q]uؾVFMĘ e6^yE] Rt=ĉ-{RQKbkQiSIda-Nų^(M//4j~" \pdI]\|ġD2|B "D$ZS!^yn3ZjhgBܰ d~t\F+REfKWąa ~o.WS?p6L1dG=7W9Υ݀OJsZ&`"ci~GOk,}uȱ:,:yͮWAmgo-|EY`a8t뮌jy sA8W!ꠔucU!N/a4~P˘}k=O._bm{KFl~۟aւd JVǺ^mƳ-Hq|M7Z=[V~|yf=2o:^}CƎ2bt<5eS\I/UfȪh0XJ5~jM~͊L2HSʄe9@X֛jUժԟ6º'0[_˼S%⺛unT{Wa#S?7ўAN3enNhPZ[W{t:<ۮ+Ujm|~5epUr»0{7~׾xJ>.G뤃n" {ȸC?]n_rfb=}Qq'pu{TZhpbѰoKyzy^}Lu}'챟qg-‘V]yy<㋐w>ϯxg}qt@11_u'INYuITC ?zF InՄ\V\fT ݪv7~B$$ \ q~-o0 x~"+%fm>.VqeAvG`V+ 7کdO7?ȳ|\CZګ/-k^[+J{CX!]?/ d'; G{=w|Ck+%?[r.sG}{ל:,<{Xv|j/nGz)M^ݫ3y6|Ӯ]W=U})t?8Z<G1]'?b^uS]n&w v N?Qp2]/z2ad3Ml(ˡoWK&fź.BQY,}<$Gb]fG%ˋ(9~Oq:Ybhu)>P*'ndSӅ '&A(Ytρ03-|K t'=U"M?E\-&X3bBԩj7J_{QG*>O>}~(&SBjt\C kA j)g._=Pd/cR5%%* p1Bxo*8h `T'17ZL~yқAǫK熷R}ߒYtû3IP)v-wd )= \l. 3g^Ub tƓ8+g j &Ӂ\fC hH[^aAN$9{n'iDhqHۃ)jVЧE1MݮRsRl[9ۤw+JIHEZ`p8ۺQ ݓ" Ӭu/}.|3ճZ]毼>ؾ:OlӪ[SvUZjU\y|sT_|`lܙ5U{F^h:]5p:]}zjq#MJe[S7c@OwZJSj5hVVGekl lŒ JyjF ]H}t%Q:1ꔨ%5=J8Ym;fsݪSZ7S>#q +_k9w2Ty)&zBy^:w}=ׅʺw||d<+/}9{{euҢ}{Ԕ@U(>}]6;">X,aKTevh`m[z>yGQy1 nV}K;]@ 3&t2_;>oG`lKܽQ|2]; ],$=>ӕ׶'Ýj[:.[D8p;{{.w[%zOzy4A .tnO@wf>h>7cxmeλ+MW+.Wݓlҷ潀ڣکγ3l}]lfoA={W=nh}x3Z: 44:t!{:})BX]sS)] a@,*nuvUҤ}籓w{}۞_y{>{6$R 9 && &a4 3a0Pjh h4h@0&M10jzjzhS L hѦF4jyM&44Aa@&CF!6&aO$hɈdljyLLz&lTP & dPI  FM2# 4MhM=S'zSS5OO&?BSR~MOSimSoI$F 0ie<КzOQОLM'U?ҏѐTOLOSS<~OSh4F@1#hMMOOiOI$!M &2)6B0$ѓLSjlDOɪ6i ~MSSCOM){TSRgmSڛTSLi 4=2'|P0UX Ȣ_=G>LΡ12M"$pU$"? EEST{?~$`F:Cw-BpjzWro/ pHK}R @8kkr ]P`QtpNzΝk9Y4ϨCǼ3nv(Iw?{Rksy647MUkz)yB/,@E ;S~y|Plr?GfGjxC=oso_.mh!ob [%hХ$-:=JvQMW:Jv߭)%AGWt62~j"m~ ʐMYC·+[c*`ܺSܾ3_ |8m5xNw8n:fpQC?S 3c9tJZ&k70sU ؔo8چoy׏:@v+m@}h%%CAT(ӯ#lֳkSp\;+ywռo/kp|r#\ڥt$"?Aԗ' PEs,D{Nl>r *Ly93iǐiusdϗr8;B֫q_F s@ =]8sA }'%AڅwNXrg, >j|: V3]k2;_}z5!Yٽ*Yf (BH.|ˏ降G fK?ٌ~R$es1Y-^ߡ/ .2XgvMÔrp>LYt͸E^$'5Uv.qLA:v; 3Te@dw C=S#_smtm!%Q0b5 >v+ ӿ'r==K'N@aIJÑ,0ڒױ/`qXI%a)EW8q_ǵMywdz#  10RRG9,"{ͱ˹H]9˖xsrDfAѱg@FCP) @.5Ǹo[xc3a~F$ɿ=%9$: ɚtRXC9gmG.ZۧK_h^'es}̨2pK H #e  c$=9bGPύ*nfyCQO`bZS{v6>NE*LL/r~gE9!T1PA:y& .a ː2?ZmJua2nvZ  &tzA +EBΖtLfC+dνƵ3π4CY 9ZE_'paw!)W\I'rsQ Se8Oz@)(7j4ϫx7%2k):źY,pwÁDsr3# FῨB۳CQ[hyEo=*VaL&5)NjWlr;op%27x@ &CZ֓3w!j{;<;-cM^zkz'3 Ş+̨|X^S?PBb _sg+9]1X$oW2({'u tQַjZ vwexX2r[D#ymHp] w>9Zcκ,=wޟ':pێ9 N!-@E1΂3}S`)-|'IZgض BkCL}zmG?8h{% 1Bs*OY߯.&-vaR_p!=-=y DOqԎp"D ˝s֦0HɄ0it)ђE;8mKi+T-} :ةv4`GN<6+7z[E^/t-e wh99:ж=aKBǾ`&"#qsU㠑0pz>0N}``E8!0?aC'}[rqpߧ9֐LӢ9zāDAʚkwy籫w~KZkOF ! TN,omYh6~mrј~=[m:^k" 6N36e㹴 pF)³2bf2 Z]Mޔ3;RTqrEҴWHH[.=f8\:=.:T*tzFNb-d ~B-uefm43@ֲюBpC>ozKt{cdh1q&]4#$rt`IU<>awmLu I)ɉOjGYuc']g?9 ô+&joϖu80dYϭh`5r~ ߻8~^[r_8O(9;h |vB.|{6721 N&$¡Nb' <m<;A.! +kel$b#UbsJUB}m5R֍ٮ@D 4`C?us/M" ("GuS't5*)bE,VEXATX "4!_X>6Wf֐H"1V X#o2wU 4@Lw]L v߻kjE2PA@œ8wzO l"PQe%E)=(A)޸2N;WXT`LXT`Z, %xwLb/Οcs21T29RƵ|^O b?mv"0Dބ橨ly!BkG%1qnpI]/[>suOAcsɔ c+m"ך]WTzl< $0O~=6mfdfi2 FIإCJ%k?yw|ϞI D!Zme%,JasʙџE4]U[,t/}z?X.8WMK&B4 7c5|l.ơ>27lؿRnHk'ka3\ik%XvEiic%0wn[\Sw#P*D^Hcx٬78_ٷF^{ *;C;G P EF8}D@ ?U/HW@N^gDm79 V{ А1,Px 37 s}qvz= ݶA#7ܴ;?^D5-EDxR{,tܔ㉵!b {/S'wjsK'߿5ǾPUz!~f.EBp2W[N/>=Jj{22?.oJ*MWVH282-=.'$^iq9Aa? Kw*+ UXqJ'hº[l۸8L3Woͥ|҅qph;LGa,}(mt3#n̓3= `KSA;.p^ea[Mz>~)>H̻ĶZگqmVoq5E굞YQ" ʣNe 8j|Bg1}P%>(b LU]RL -kMU E QH)i1UU5StSV6SE]UeӤBxy}+Q~ߏ?lflxܡSsrNzD"))"0_O<}y6CQO_YxDDDUFXVs²*1bUl1HR&Iw^&Hby_ɾ\)x'ԥ 5cQ;^fxΡ[@٬I7;Vfos웇ÏɫeMlݜp?ˬ]H8&ϲLDܧMYe#i1cba-=U%>gxvq/Vh;Cw>i`5$BrCid pyE\yud9)5 SA¤I0E+mۓ2SJXBBa*!wdf -7=bLN@=.\^QIg[bR?gr'nzܪl8LM1U^cAu q|.>w!Ph5p|ryc1,Rx?]v[Z{kba?~4ީ6}ofX~&لr%kSܤ59M<))cZO'f1r[oʽ@ЮvQ`j#UaM4:as;Qx4VLp#.$Vm{?mykN*$ΐ_ k?ڥ6bmԷkM[ K%e,$QI)c8mT䇮ݜ##ߛkWKohFJ2(] [jY9oṀ̙r+6ge]'1wp$ڲ`g0a98k>k=n9Uۜ|†4O1E@} /zo'UvwER<1v,zaXy BQA>ZQƇ*2ZtEw{*tx2$\+joēA23@ݨsg2F`σY:+v6l[J> xȕ*&)+Kd'`ӝh*HJB_=zkzꊤUH0 FKn7 vwU ˥_DS/eo//Sx\3(I6=壄dOGrywaBZ1iY+)s3>BM{[?8Ԃhl%|cy){>K,it5qoTRbWnWф s<2t 7WV Gsٮ]jX8~u@ hȇhy.Z^jYk!U= ^{BV2N:w3!۸Y:b-~$U@޽ou"rMXf]d=Z̐9tffNf]xܮc@A#BY,`L;|k5!qo[E^{VņTb@C;M"DQ͠ɅKj[ybOu?:e8}!XNͭW/xU>-~ULpxEu'C ]_ (_XSUSf7U B  c E$qsQf>tdPaJfME˼,+4f+ Ǡ=5C ~h7Q(dPTّ@;ea:c},9;=k׿'~z8~s~ǜy H1Sn;Æ=A+U>-4 Zf'VO+gVq^a7~vύRGc N^n`(,pe)==DUyx4Q:ZZƾeV#?S2#Zĥ:&p`E 7eL ѯ9?j]oZSxWz(URWI48a?W~#\eGk H ((=Ubf>VϝČʇn"VJ(N7kA1E$`_͊j:F:2ؖL6;3_S&?Y$:nөbHNÏ[$<: w GY{2pJK̒JoS%ӐUN-s]G9:ˏĽ|.;[162HQ-;)SSA?Rm JD~kcWWBZ '9 3 |B;5Iǁƶ.9.wT?Skq3;~eH4aD$kdL eߨ!I۞7oW2-!hi9j1uX)sBVcW8!*C[vul%5inoy!=ѿkfݭc#)VʑA/SzgF2e?&||?C:G)>(=Uh鮩!pCgdjOLW+Q MZ@ ѣY9yZܡXXVO2Q"yeȼugKAu^,QnX:Ce–|sT)nqiMt7F4 +EXu:txƻqii/D 2߱pq'ާ|Vc_:PD`ĸ@f 1iL_,Ŷ>9 u%v|0ԷIX[=+6f% H\ d]Tf_mN]A. )tzS*1GAqP.$jxqtM";Z @ͣѥDEh`9% Ҳj75s7ހ=aew1SnEI"g2əqI#FHA2\[aYf.ފEFKqSy fwxeGd%ZbVrlB- @F(>t}5USh*#@09lΡc'Kk,/`䃠Oj=l8G9^O`X~r*FBI+:!0U^%飋MA B&F`p]v7j 50`R1{WӘa,}egڥ]o#8Nךd8txgެ|v;e\#._u\ gTZǠUw ?A-(\K<ٽo)<,Jr{yz^ޅSBw%ySzhCm1I1jӊ 1t Q$$ P,VUz'6NٺEA!d@])H5- ^gV$+ܺؔ4$)/HSVt)F-C!D0eZ_<`A>&a62zڠ 0qB6т*Pӏ9R."_/$> >ȶHy(#&4S.Ƞ]zUXSuC'9#۴h/DD]iENbmpX]qqk`(P1'5 myu͹^ V90sha.FZ0{kO:M0;?YhÅz)l8Hg&<ޛЎe@X@JbVb#ww@V̆ ;h2L+3m*]?&;KT(ayFl׮L~da_ku$P (ɽNӲp3J볎DvKtrYZn"=a0n] @P-@VHTH:4/Zl2R N P?\9UJl$(BȉHNzX@d#2i? @)H*$!>Tr:D!(R() eA`.=Ã\G?ЖbM$7V6=OGh͑)b`FAhηGAo;/v92fltŹaPGx\@C@N$[,4E0B6ڶJJ]q_ 7/Tef* uA`oնwlb7n&:o%cnpC3Ðq(hP_?VeFmZk,nV@}Y!&93Bd#0CfґDܚq9YÌ# yV!+uԴ7ָA p c:AW)8!*>E;)8ȒJx6K_ 5ds0Qc:1 1wJLh)(ɕv z/~RS齉( % x7KG'$Qw&[^>v'奦@xrDZ9Yg "$;N{ e] -e+/ٕHZRScgSup0fU0VV(0I3dB5K|zX=@W;-G VMˋV3D3-R| ̭?Q?@!āj?33~e+,D (ád>Lf<̈́30dVBԋ_"+TV$G=bծ|,"oui*$(`A cALȍaLTUS^6礛 f 8[ѽbi_%RSD 0F`)(IvnVH3NkVʛ7C@"B)@ CGm?g1mzlH8;,1B;mlVųk R6fqcdzIfK,g$Ԯo,ǩ͞ ;c~K=MQ6D.gSUa_iru{E}{@ H;S$`FD}Ѷ$D]?BN?8(^%^QsK&(i (8$$$ء@ŵr+{F eH*$h O9H{D:}UKc]=R,"[*¨a}; Q0TX*THKE*Δ^=?rE}nrbGcVt^v̪>x8!@I`<"/iF nҫNEԬp_nX`a] qsjxVM_<҅wg px}C3R528<0B _Pbk+FYp9y8_v37@%ffͅdey SjUX23jAOTR/{mxxTb`0ݾOW,00F@u7>/֔XACTcYKġR#wwӓYֵ7, r BSαTkBF!&J>ϚqHoiӜ}7<7aݵuVOڹq0)x1Cb(nN=x/NMNlj׶j#o K_`d9X*"Aڬ!aJKwM51cpOoUIR @8pw|73'{pHbt}@ FSY *J<1U*cd$y'W¾NLK;\R\}(oUx>ڱGZ߷ 0}XqҊzuZwHzNj Zrw:B( eT.IM^CY=E0;I<}Mޛ%b\2'\]ӶA%?iXDVhqe9Pl61K*<-Fj0OfPR=&K7zrDM|.VRZp4.(2 #b_D򔼝8{@2ct~[˨%Jw 0׻,ma\Dtw*yYa6OprUNq*gdY#|9l-ss]1!>DkȽV#&>[l/YɒԵ2]t71 soI'ܶdVgSܟxLَ~U0L%1iLݪ1Y{3K?W#Zˆf]I%W: 5 a*=yc,!QW$ڤ}q{F҈F( qh2-0V8w;a˦rWa;]R|E$Z^/Rk (gVݪ? ] 9&› 4]vkhVf@3),:Dhu:G4o.܋G]iܤW4L?!QE mmk /c۪Ipǯb#̂CtZ#H*1.vyFEO){{/=QXnq#g oz<$rDPkgtﶸZ=s`$g 0C 4 ,S^ fAʒ31wf^NgTnG=(9 Db&}hg-gFib}i[AK;4aH4K+UF"Cle@ƪ犣aˡb UTy\N-}D:oEnpdMF&ʲFS i*%'yނ;s/)TR}>634v >3*;@>1vC]]6=*(̡dcWЪ$IoT;-\E75m*/LPkcvڟ`NΠ M1{֝܎)1{$Q`XEʤJlv0 \(Pe;>G'G7Z6K<$ġY輔1_9 'oEj@m\s7ؕ~-+zBS~DS =mt~>/*GÜm[[1}gCmD-&J9p#%ly)$Hu%GP٫J$=?qep*LItˌ|Xn-[ߵċbĥ E^'EFSG)ͻ*d.THtaF˔9bË(10ۅiV?6y4N8T[vUD52pjc"e=V[æo\J#)3wo}t-[/\|ƀн2ekpbpxP#C,v Re|s g"\Mdh?_2)A(`[i xGCy)$`F'?coϾ T! "76ʮL!I0wq=M HduE.8eTgǭ.r/O@햬 5ۥR wBroS#!KY lDˆ{̦q8kj e6RqeNؑ5x*8cY2EK沷vP9l9Y8@o'h!lZ-ل% yytj⼿/.C|-)#m0"AQ~NιPz=#LFm<H EX/=QYOzFK<#{*Õܯref)U8PZGJu8>9Xӽw}H"QAbPdǢ}_/Cg7HT=JX!C&+ITYR2Aݴ‘42-~ G[Gl_KiT;NWƦ'7^x5uЛd5e<ۋ1d7=lkVGU!gl2 ,s##f'*>^ts84īp&!8mw$ۛ1kl+=Ι2^7ECgrߒD?%.E0fDyT{ؙ !)~xf91$@ic>!i1+rH'mw}~jz PV͑>@`y|[ΰo N>F6+GeP$Q^a@݄KQSዤ_D#(2"N VS Xmw_Y߭3[lۋ1<lђ 吔ѷn 0q=;CcVܰ`,fg3F*ypH'II*ro00izʪ+"PE,iƘvZC8fр g;g2]#գecl(/YpirZ.Hq~a4ŌD%CApeKW+]&p0! ;c8q#"QCOTrJfţt$3 %v0$Ъ1EB j\E9|azÂ=Vϰ|)>oߨ :N ;U4fL}M^!euu(`Nrn.e o9TU&νe*!My̍*&o}wִM2.6Pe&eJ'J"tYuhAҳYJ1$jdYyÖ.!9kT/vLKSq~OַH@D$&fCʘ?/5v U}]ҷZ>F69LҠ=ň,M$a4/}D TO+ ʄ RE *kMge-o &R)*ITA۪PAӏ, T{56X/ A"bY8GX(NLdsm8QiH< -BWJwKrV dL@߹ڨre(ӲB'䞝 shsԀ}_R%'Kǵ~:x-&k >kpSt3}?gZR&lv۶ ؗ,}V2)0k d 7vi\r^lM켮t|2#dS轫egQsD̞S sAR1%t謰ӽb JMJ)B$d~DfMlP[a."vlF@byӤ3hLR? CqMBVsS=QH&hr@S<k1iVtxelvpҮ!&è HHJ90-Ʋ JȧorȖ*_6< N{(V1x1[U::&y:?VIeތ> 6Ij1ֽe6k$D'MD.Y5]뇌u+)m6KlnV,S@xAVZ5-8WR Byx~zؖdoV )hhH3g:B@-g"Q[a>Ff orsdp=q:ED3 !gՄW! У\ 8b>}ݫ m4({K"3q(N%>ׁrsZ1!5xmv[9$I`̀20Z9ڇ@qmAEb4`VM0VftTEU35%n 12nëF#)FD9ce'r0HL*L9Zgl0{wR[{ńE.܊(wp2)pUwW&ZzMG!ip832` Mms&}-ӫx;|59 V꫌2qCxԂ.&{"H+d|M7<:(cN3h:'`\RoLҼ$NA;dI%Zgv<?k\ 'klu^T9>9<ǕDę]JÙfCнr+7wp~ }_YNָ<<놊 4ra7H@nZ!JU cGwEd K0Ԟq'EVsmT14i9vE\8ϳo"\7uXhg6X>f:(~Ӎ\EMKp&ڀF| Q!&$>q‰v/^vvyuV 0bƢBF>][r}-B=OJXS)Z]%g}yVq1ҭ4%QR_xD007aETA3yrAk+mP C?= "UQW Ռ1M4-4H !J.hC{;^&0Q݂BufvG09Qz&z}B7yPC!x0 {턀' &Ҡ CX\M7xS ^׫Ƿʃ4h3qF34ylݐ7c> BTu+  W|;TZH2hHIpf=Q͛rڐB&=YAS:b`6kڕ%ā> VT;{FiK}^j6`m:Ӣ(G5KdȮ-"lcLhP}DUK5:X yPQB; k t:9CXзu^?Mjzw%29:[b@{ t"Huͮ) 3mb1hFR[^^f6h9dґ׽7heEpVepN9Es}k]%EIp,/fpYf^Vv!ĕJtqqIef@A9@p fӒXAtSBD0, @(&2vwL01pGD MXlh8;̷0NRqOeu"64͟s&Z= }e'T(fB :ʼnewiVV=cǒ:\hO<0f | X8{G8q `}qY&F~=([AbK}^}9 |B 9N+H̹)p6X;1(iH"a(F0p֓L^4G[`2330fJ +C*g] ˯.(/Īv{9>. '~6pUԭ4S$"b]!c6 ŭ1ʛUr+*E=V 1)@WwӘL sN 5Rw.j1"5os>'mꐽ.^Qf-L+oNQWfS8cfl]fr7"% Xy˸,o п7>]UynjZR7ۋ-bN]+Kgka7C~gOJi,N,tɺz׉`Jp5cf/3< vrfGhT>]tꔁ8 °FźFY0(Eų(8JUL>< 4G3ih!oz=_CxFp߀TpP`݄A"8v-ܲ]HڨntrQ͵a\jGn"1.ݾO6n#V>:rطQdiFJ 3mm~kw lN.=<H-x k, &h :Oa=qZzzg` IW#mAe H [Jxө}N^9K|FtUzZ8BBI1jMkXw[֛ļ2)/2zݶͯTF+i&;l6)Gl!(V7Km%NGe$\=i;!Q3<"6ktCm{-vJk A(/JKk>Mdq!,A_ CKVWRR4§рQqT/ {8W3}0.hFD`3hČ>(dbLMa痁'͒MD ^dYyNwmUj^Ӽ':1"'O?}CQ% ].t `!34j I&3!i<ҶjG *$΅{dPT,`5:46zf. dIHY#H7 U,N ҡG{&}jbG=kPAF;ƜCv @e] Ҿf!ͼ,(RyYo?X@bAL9F!H#uq0u$wtjdhy!9X4e۷z2Lgԣ͠(Q[Yc׃E_K]Bx)LQ#4 i^Y_Y W!P-&wgI,_j"-,a3+atYZ2oo0FC0,eHN4c8eFM^2˩|pp[+KgHac%¯lf߮=9¸@eyƋS, ցƧNhLwޠ2\.&T*2wp(6d"r-2ˑ\F*0cPQkӫc.Y+CA]VG/:wR7e7\/EWhNs{t@ ?mHḷOl kҊZ7 3 |er77֋i>VYhOK>(-S.@xp2Wwr 27X/,#D8DJpNqMy&XDfǫHejpyU Ffi1XYu;u[{ EϪ瘹nɫ6dT..GgwI {@8Ydw˯|pyw39| :!(Q\MLg/Q>GMyX*Ə I@B ~+ |UٿƓr'M&9oC䙤AK+<# !`;Bxd|>}HDw1omXr,1EKQKƼo*^)){ `t~azTqH]HRy C r7*Y_OJFu!NGVi5 зQ^{v;{O㚎*A0"C& ۭ% Gq'% 'S"<8X]馇ҟV?5gV\vƒft6}RjSvYmf=W3FȲcGUv6Vￛx= ^xeY0sT]qmȆƪt3LuALhV"uP?Ǘv*&E\hf735r4m;pեύ+cuYyK1#2H#9B V;հtN t+6@ % )pԘKX+[@SJ*::71vmT-] K%5(iۭ9@2 :xT)1mH0׫&n VЫ^e0ܯUl l*70,O߂L ; CCJzJ0Uw6DhF5gh7 Vxۍ `Q7H'4mVLֶv/!qϜPF@Sn3kq:VtmOv[E ;H靎8`lh,'{Zﲚι캪L l i6Qwb5P@."}I\8Y˓[m=-;<]OmHs>86[/zXà Yxdw;Y ,X .tio]W0:W/Ytw}sfn*  ڕ`b %}%D4c3XӘakz--uRJ}u g9LMEpqs[GjKA']H{Vq-;S8Rd[_ `Ơ%)lQX+c3 P9HfD+s!pbfG daK'9֏]jWf uy{D-^V3Ctto\'?a>攽Pm8^rٍKv%.gh&-;?_S;ҫ+n<>.Bb$4WQJl "IülVwu"QxT;"cxcֳ\9v؅|<$Mm'LAg;NvJ#!H'|KMf(ϒn 49TD Gif^P'e?CTuB.Wk]t<IGv7A#Gݣ~TW%=_UB݃޸x6B<"D|y4p;!{\Bڶ0‘\k(sfI$ k&t5mǑ:d;!o.29_pwC۔B^¹"5흲ҵxahMb:numŗnŜ }uݕq8[MHiE %BSyǨ@[= ρs}J{^HU!m7T  +1aRHe3хm ֣A8ɍA]=Ǐ`1ȐoLuh'+TU^x,%SQғmyeQ bW[v=q&0R dt(pȾ[d۸̺u*0l*;VF`!Ss3c>L鉶7(po $c (Hx._-D3yz()Ёtq.MA.˹p&{ˣ(}xj=tu'WG*xC9ѰT;!p㍍(u^Ho]9L/PyBK!VG朽܁{w< \ilvg&v^ЈBRuһ"}ՒH@L2Zp[vJ`RG/9 4al@ SZ7H_ oKR!*#9&RbJRP P%UDd nzN 0PQR*Ǡ>%3oGa$T8o  NG/ۺTi2h"/.ޥhFK@iS[ZɎ lU)0GEPmulD-9--a>>;7PdEX γ hbPA(2 EQ2$:znVA$R1$ږ4M7x(EV@TVw|)Lh`TYT0T(/C4Otc5{Hõ8g2`J8""`5dž8{sB0vYtX0A!浑QyQmǀ׆mH %0j9S o~nÄD@h(~DATX Ոf( RoPN5 0MD $+Đ뛶ރq ё3u~pYE+ϰ%KlE0ATxH)D%sjuYH68$!Pʔ" tAWm&;W$D?UFPvaa+( )V1STPX,ŐEV(DaD}> ơF97U'%r.H~s/(ᾅfhE@'ܠS> uV˽lb~Y#%UX=/ZfQ@B/pB!/t:M)i%&Vf8?j<7ߙ@$HToLz@HP;B&R)cDZQ~)\BRS dFmgS}Ԡ[02^y}c(N+*i\L.wM.܈a=xp:1q@v(amE7ӟ(:tݺtR pH|!ULU~ t'|Ox](kcb_ϗjihTN;_!5aHgoBi8PDΞ* p`g:7{,;9Q 6bKM9rH]NT':a4CDMJ˛eV %|)pe!l,$D>Ԧh`lEP6UH~; `/5.U|XY鰐E;COIwވ͙NbU$5띲A,EϢa eb䫭tak8Ch{kE)5L+U.KDK'& , OV&* 2RZ dzh "!eP:Ќ>j'̲KcS)U<*Z6qn eך-mE9Yy1olaGDɾmHJ}H9:1*}Տ*$a-iSbDW}Hp:-l().*}?im$5kh|*xZ AƒZWmPUP MX>0YDtYdTX*őUH 1V"*1TQ9!`}Mu}>,/eɡ l6OU"U1EQAQR!8ӛ`H;)q"4cc)Z*]8lDxJTZV۷'(̆{Wx *$,YU-nNr0ۊ5k-AMQLQN5ũuKtExqD"QYFF("TTQ*(X 10E@쌋TXF,R TXb,(,'%vMU  Ȥ3Ǿgr7~~0]z.|BNu_`Ef ]AO&7cumCx$SG۪PTpWYyR{;ȌTDn> )*i#PsQ+⪆dvڿI`n6=~|@/P uBq <8@#8(x;UͮwbX@$jx=[Mp $b,XՈGásվ)(BIN(,T{<ǭ.gXB t1EQH*tTQAEbbPTEQXTcDbQTA ,V{[9Xd^SWHRwPar("Xb+`*QA`IX_6+I` @H$!!Nx"=Ŭ=t6v*vÿE DAbEU3ǐO͍=Cw=W FxD*tԗܝM])Z^.֭(;T'a i\&*YF&lc_i䫘Y^H[!څԁ2lp҂ U` H dQ@K YAVRGe48jZY=TyT#:٠$HSRR)dzjHdA'79iKD3b"!$sϗE2b'~@GY[Ġ$?lVu̓UE#)QH l1j*K.t/oeXu<^x=Ct{t%73% ^-jb^LUsiϚjQRTzXqjyRQM$T;= 蹝>X-NG2Vŀ *SLQ*DM,TtT~튱?Xi7s_?G+`(H gy ?-;=voMTUXHEY #/7]Ї>'9A^ZtPD+<.|HA@Xkl40u0A:.l} =D6po b@$Ȭ nAF482چ4MnKC~JANEJ@wm" "0{;O]먜ޟf)Sܓ7B }'I `P YxԪVs 1CmzF ϙYoq ]?5OV8* qcYÚ'&ppVyaC~TϤsɇͭ/R@f^~aQiod=Ld9z{$  ddx?;^fq;KO2.nfp^M"(D&E E" ypPij" ^@ {K U c` TETx(*TE")DwȨ sZQIp@P*㈢ @ƢQsAw@^NU]h~"b*o`*pTi=XڨK(HA ͵ʻ7^G[K V4lt0M "A\PE(##P*"!(T(0)$@XY D HP-AmW^(hED[B*Bv*Àj"D/@ "w{_,@CCi|x'րpWATȂȢ0 "1"T$ تQM|G'kw=[gJPUQ% Ly7&rOKw| 0]{΄PӈJDDz( TLQHsJ)\$ `&(v#stA_h"/iHTLpM (x/A9}Uj"} XPbd:x rxQ@T@LH+k)J34b%KFD{Ίtvp^2)C6 x("'ADN(~.Q,¥JL~U"A=qYj9SM. *:r >LQAᠧ_ pPЊ+ eߩ EIQ!rD|&S_en!EsW#҂ia|Dl]J.8x Q-<h"jWV(E_(>*_1C}W;_]̈AƈHݍ(C6`xb Ar)n b5ά`PEؤXւxmT;؎ŀ~ع },T/ %q4.A '8b\CTWb ^I8B0І;[ "qP>(u]8A/1#bd,( *2 @X0")b1X1A FIC< T֦á* ߾i짵 JDN*ZUx.o_] NRGuP;C| {L Ycma)uOG͎i󽥁@CC4 Q .UV6ˇ* ə* t G? lEҊך\]ڼDp]_,a@8{A  i?㹒+DWuKT% %. YAȊ7r[*vzT>qGMcHRT$b@otlo0v )Fc#اWP6S7ՀC^H9Q yO\tR&_N-L} Xs_w(|rcģA5⌍#N'HZsɛY@1>c[IlXA`K_Ig~.PW#󧚒܋ă2 Ng>9 ݓuDf"%~ȇ[<9kC0lu{q1K7  L4x-8ȇeaQS'2zy^߃Lz}^(($,s}OOuЭ:)Ėdś"R:%@o!,3HHg:Ȥ"L(;wri|*8bo9W?d?!Gv<_B < le4;Xؘ5#]I?߭~(]+sx=ze`A F'֏F4*d3Wz۔/{ڻwf 4#zPՊɰA6ў8|+LA|tOCnq+x8 ex 9 _6`w#٩݇tuBBIB \B8?;r$_ֶDfkOУ ? 8WUÑdXu4s* 8Bb6NV P$;1 WNzf衖߹Aa hԟXܐCj*֑w""π晊yL{WeZ ]D X0[VǢ/jYpAZp}Os}Ylw{AX᧠]J|:1ݿL#PtP HsD+2(%/nyYMMʯg4c?(@04o^,9FPM!f_vRUt79#݌䆽uĝOCw3ywRwrM#ueW N'94 -Xz?;jd2v;Ƚp]ܝExR(b. @F,ָ[H~15Sk>.J*#2H!,(Jj40 Nt@3=TE:b/uOjӖV`odO< f#gN9n5|~Z,>tI'uַvL2aV70%d' 6x! ; `IV!d2.J2],L -!]m}zL e A@q}bI}t<`v21vݲ kkql}Í*zo {d:A'O?qm^?'|he |CX|xK ;j a$׿K0Zcs.ފ#dq7WK ¨u̠)gz>ƢpH[VDddzǰ᷽5Gk`1ԻHfg1҄J{۲6,fXD`ok'Î ^CV%굴3ѣ46/֥NL*2<׋iMl&)IS*w-z-4A],Q--f4Fb@JQ:y0rtDAT2s@\f@ ;5t5g&$ܢfyjTCB.kntvv]Ix;f%W\.>PAwҡ1e89OJ~mjجDu<i0"#W.gUULБXbfCJ j5RY0Թ.h'[FF}GV+ =rz_;H{l !:sRAe C4(Y>VP_Qpwl<[Q^`>O(6DD uB512gK4U0"=wخz(LhLbQv3 o9&VU"%@Q#9ڢ@/Ofkuߏ{(,ACBڑU^tf[ r9*&\@B ;^z7$Dͻ62:$:q@͵Ԙe*Trַ, X솔&!etރ(+%f蘑l)f yPBs5+>goîgAp9Lr8 fh"3+29 ⠐fe1f3wN=aO%pk9nu@L>1brl@3)YAýYC_Rd1#vb =8D!'O3[6M$tȿ`")hop)]=o;,V T,^{/@R I4?ՙY1J]M߃$ODP AV*5]G -H㠤ZF~ֽ^y5 <)]" 4Lt itK j+#d)JKf$:iBz:>CgJ7w3w86"/WyҶj%K귡\c6?TcgaɶҎ\L1ms35Be jMI;ͫGK #qb"gE@- 7AV Y@ANt@\0S4B>kgz$AP;,9qLkU QLQ`(40E,Ex] 71-`/cD: @N"k0 P]xF) RD@<(&hM @1~lPQB&HZH\Ј&EnH>@]j#"`6(F(BgQFG9mr"=dC< o(齅]Pџ.s9)Zk;+_5C5"jJu".r2 70EA,7Sj'ku=_=Xt<|U(((jjMS_h%CS,7 J9꩕R**{e:]%*^埃94lZ*/vQnw{u(^ը{#q(2(;h:ӺҺcѸd(Zm,#vi3hﶠ5XcC^u*`|3x|Nӊ^Ӏw?}5R 髀d&q;?OO@EֽS)̟7Ȋ\>3KvW:X珲flvVK|{@З\ Re3c$WTM̨A$7t#!=4QY;&}`6:|}s#ֱ9.2N &41/>KD(hjjB ocBxdcg3=~⏡]Jt'nf{0YYroP#}jz:nr\/v54;Wws$c+J0U|= U 9}+؁zj 5_ ΄ `,r DDnΫc#M#K9 Ám p1GFV*9ަWT4p0pF:X"~%%:giBl;dWfj9)A*?0#|K$ aְ^Pd6c- >>OPth3ƹ[XZ.᯴ iX'D@$ l`c,WRQi,ո-xp )N⥺ĸ`^% IՄ"&{,_b]yAq^%\HnæЅLjGh)|Wq U.mr*4@VQdb,U^*l/CʇLQ/ZQ܂{x-I"!DF DbYYaʀ:H ! <Kku_. |@O]9g~Pk:T_*iB\ XY9Q(&9ȎX!\>忛kp\QO6_6ӛQ$m9,\VeE~GhC<[X|Zd~Km?Gy>LO r* CS@~YjhH=N*Mw84&|eg)-&]&)4^);y,^6Flۋ1ᯋiخΑ/fZ \4AhQ4߁KRajIob뗙킍GßY0=1nA Z9ƷF_.ւى1,(oxW]p7 U8Pgw_̣u45 )?@x7 s0 lf4DN3 ȣT~z OYE|EĉPx tU:9*w|:".p2@TAڈps  !dTT#$$2P@k͚l@? ZE9tDSv;?Eh׏҃řC*c>;\./8raPPPώz8|DT;ì1'_>ŋyvAfDC[ =̗/~l_ae q-!!zb[++>٨PdВ{?_u) Ҩ@JvWmאڦt{߯v\LlVv%! {w6f5gg1_uMsaPMW[5 ㍺__^6/d. : FݯNHGbYRFV{~>˹úU).ĕT [kS,}rЈu!s, kʂ1wJB@nn0ޑ/*8%dqHF&;DpƮ{\W@nTV&HdOE"2Zv:BrA.4~ U},_l77\n:%W4~h&Y \$wL؃c< ED.,Xu$(MF+uvX)ʨa` D)qx%C3=uC^isSDitFNQ $@@ Yz]Ui6%1)q[T6JYťT`'|I$/E@"XDzN~ejTI3mMYV8ijtL۞\(%;mgd~eh8,LjEdM#삗g⵪&BbA 6v59" Hzk0.\Ul.2`wC-MP2pNy:D\Ɂ\N)@ !fO:5[^Yga8Nn2Ys('({s7 9Ӡ&@MﶒL"DU±EM6MD!#E7i?X6l3^ߗJ@FXt.H(.e%qao@J||x<"19^Uֶ},|sْ˜'TH3TMg#+s)ZF&2Ρ`i=Us S},CD:R01w]oR%;lĜ=&:10&) MGsUCI0i6 "JM0ufzWf1-'de&wzש;L5 Px!.[[mqC2l-ywl (OLå_K%GQ7N4Ͳx.^ùPξ  m\9x=??Y{Ѿ|Q _ 9Y6uxP)LQfJ]DL,`d|t4Ba`z_9og;<ߜb L PHWxwXa*SG ӛd RϬCrKTX[1jh b+C5wyq$""L0JI) S](Z&($),FvgۮaYݏ :U}6, 8QX.=KP(teި 1 JyH֍t/rkKWJ1 {t BPX"꘢ZQ.34a6a5;qZi]tJ%4D3E@FDE0E**XA0\oRQR)@ݖV*7`M pC IlRʨ%f%Je]mV60*Y`EV+TRZTe**HiNJ V.t))ZqTA:ב(JaF(bM1~-P^4Jsttctf%QmՎz^fԈXʊ/EקΊPmڄT{o+´?TxZ=P~Jw` AErr)Q./Çd?gNQa2y/y.Cd[h|(5Zɿe{6|*lq,\&ד8>f]*kh`2 křN #=`RaG"E!0AgK\[uveBAT0]8Z>qL,*Y% -VɫTPUffüi-Twh i!(EY22!b@xӻ- !ОkaKDgsE刷L|:(Yu_vq"l-ShB<*2)@q@p`F@6̈́{cq]ʙ2F!O47ʁۭр?G)Tc2v]pf_9; GOmj ҏowcORĎ2ym|4|W=+׶-9HK`ϡERQqt~RkVX$ 6>gL61ޡQ{,E+t-}Š}Vf)oBRSq@西Q: e D(|K|V8C83* h/DVI <$'!E DN2X H|OehOKT2OTU4R͖fyc#cH RYAtUN-j,/cQmE+/5ЦLxHQh.|_ޫ#*xs]~[M;{@-)^[vU=;䑬N/Em2bOm s?#և /36yr_-G,ShPl{8`59 IdaNif{um6{{2 ߈ʚnD"@!p(it<™'YcrBe;J 5͑({'wS^{?Gpҁ>sYHY_:~be1a31j!Saʕ'BeSTݚzRU?| ڏzu>/+ fT3UcuJEHXt|AGư{+B>;}f<ҡeauìڋu=xQ3L5QD|&K^{QoW&Ӛ5$;lP*Q" O Qq!؍j< v+Ï0Cba5ާ-:[uRCT~zsE5a SQbDo~CU_׬WCe4 riAXʱ]Q.oH{}]}_c!&'h< f 5 IuRwLRoLSNGB*kKJ;Ǿ|;u+e qWh/ FD!7fP.i?yyו8}xۣSjT\ioc'[F&/mbs^|pP5qU }$Nr`"lUvE$Q?f"?d>"@AC"<%" AB o;{bkvufo*:#|+Ǵސ` N#khe0uƣJQa@C/$+'AG&6*:*Em /6ި]Z]E4< E=| QPR ׇ!@(VI h U[('sP |H|QLQN]UC>w [Jz(Fn,V' |ĉm7Rw=Wl a",%FUgy)i]ߍu,Z|Hs9a#K%KfWa1вcF<.+Sv[T8QZ12JٙW D D0 :hXSB 6|▘$t'.@e50B}: =⸹&7Ş&CGj р%(':WV`_! b@2>?t?QcilP]D r@ :;t NzӹYE<0I11W{aÜR+uZkNymuQUO\WWE D$$> l@OȤ"˘}J]q Iփ3`xclyüMӘ4~s]yZ3/,?IGt*0ߓR5dao(]\+Us5vW657\c-rfjdNtq'K뤰KBq?YHTTPBB%Ĩ~(yqu2&!`ȰWM"' P`bw[NoӐGL(@o׸ca\6bB:Ut1·LˣtzTLQ,xO7 ۥ%To2jRXT֍"aBbuaҞ#ʿ0"&xIϿlC a>TUQaM4O80˙d Qc}7@s^w)4YLo P$7I(r!WJa1dA& ̔OUGe!/%eծ<[6k_{ԜR;Hȫ+!5ig%y!ĹJKaEܹ|u %)(?UFӚm{: J9'A @C)H<5dBC}!7(1DJ%2^KpD tiձ cX[e*7Dy:<+Mp$##Wy9')!]$GXu0)'DRw@6Mr)NkUU̎%9tJ%T"/}moU-ph&XoV|;ϾlM%3-l t)kM7NE)9}@93#& k$jiq PQB)IR4þ|0:ۈtDxuyoEp%:rA@Jf v+f^D{.JS,nH8fqa kD5!v|k_H#dhr.az;UkLm6A%F1Ɩ/mrC5N '09Yj",C|Y8Y8[ Z7xFv6ܖ}O+U.3ۛhIJ0gǒW+eV5Kf o80;%7#vA( (\"j:F7Fw"Yn[Ms8e+KM0\#Z5ZF* F:YIO4gaz\gtIvۺً;W-f$1[D0ך\j5;Ĩ:f?ka*HyhAyRңI*VpFhx04*ʡ ԍkBϭ{}~zYsLÈnՆ%zg_f7Q8A;c6K{q Uj<Q;;,xo7L!VqZ3-sectO6La/ݬ0Hǂ,%;AH6Es҉堖;N[v,Cvkոq15,0Kz,{_hA`[mq<lǥ\HlEd@2Jn3W˔9Z`!i 5M %BapΓxGue$$9tIҋN s3:(8 џ0'\8R]ӭ!<îՍӫsպܢ%tnGIh&@SsF6;:NW" Gsv2B(2 MR}C~Y,,DB9iD*u2!e4o[͆:Hx]} qT^Sw(I*^;I$H;c\4Cl*|F-FS/*(:1HK{| =8eT Xk] V9J9%%&CVI ] |,r~뗰2:Y0D% P:[KoGi!ZݪΑu-W#JǠ,;͇#>, 4kCmcm7GUǫh 9T(#fҨΩFvIa&GT}ȐPKhz%`H\?3=>tUwU~A?qYz|osLև]k~) HA$=sM[97]vbHIo~2IieX􌟫Gm+6 /Ctw_?>ak/`];D.& d/Vf2؝ ̬{c235zhFHAD𓕊{?e_ A }pu;MboZjW4D~-.M=dyilNϴ_CoW>raۇXxWVM&M$Gn"eﯓaÚUʾxWͽZ}sxfȺ!$N.m<{` *jW+9gta3dr)fBX-L2HbXɨ)85h3Oa6U#a ]/]͈Apb}2XA݆}(e80x "3ڭbCUsrw,TE-{][b ;vC@E@{PL@H`P,T];SCUζ?+zuE>CmG|L"\:  XZ蹺k};sWX~2p#;K8GdJgj2ђHBDDw*.rhjsԗR\R 亀uvY8r@6a|S A.GIٜ̦%zS`&iG ~^AOmK #R' کg1J@dlZxxj՗`De@K8U]J3;DÌWEKl xqoKR$q{ԊYX[d+_pA6TO)q<2~ ",<^ %Ogh&O~4hȷa;NV$q9m8Q!ZTr$T!l>S'BIY$H?`Y,۸@`>̟i2T< [QߎQ:hLj͖hr fT[wFV\޷N.:xz Qr_䝗#ˏ&GW{&G $d@P&VsڦpB-W 'ǪSoe_l$TPݾ>_|Nb7Y[A_5z%%љx:5u}-ф awNf|4!S7Y &'5:];UGN9G{RRhҮ׸Z:ŷ82>:H 9[É|[YΗH Yq֫DL`4ۀDAmr?}y_<+Cc A|phDK>i+Ø|^_Zְ'PMđ94;׼e0G gB)U{`Li?Z˞!R!"b;?AlD?R \#jN lS9tME߲u6w,O t>; YC6 ?pmCO}O[F":>fX%:O3iU=L8{~Ζzoi ӣzm] # 0?<ܑ>3βY(&,8O85l(P0w֧6i%ʣ>QF CbOZ*m4 s`E6}-I/w$U^=c$_k Ȁ2? 8b[V0ƅHIΞ-wH)9 ; .)E zGڵtlF `|QmBАsUd-X)xQD"'~S7RCO ҨYXw]Qܰp=8UP)D+cV X tdY}Gu7 ^q.yP*Q9能!*@=蓌FCqL|Z@eN~~!§A򌯼GUx=˲(hpbގXB(?Bj 1 t#J^x l+mՠҨ.e 80P5BmUqAB-unB61B3.Du7r+SMWk*Cʼnz) kg,,V3VP:Hro!i"z nx ~9z:rdc+#5bn@ᬑ!jRC/)dKBǩEd@ ᙢlFU˜ 3($焅H_M&y)UJ[b$#yof9dztQCJ(nulVn2o%g,S&=l@ii7hD [@ML6uu^+ef0ĘN& lѮ!$M]l3p o\z+(eoZe3c8[&`*zQtޕPM6V `2,lj})X5RCFA"ilS58!HeJamMp>[PRʬ5"Q"НWn-x˔b~h 8l;a8"S{1*9HN8t{d@TaHڑe.«8]kZKg SpE`ǝđ&cl<H@iye[Qmqd J",%v,ew׫qe[΢}{EUQåre,EZ|4eGuWۭv^N_d lLj0oZ_b['Ԥ 1ps)fzs(>?+Ev=se$ߔIQ*7dkotsmS_aR~l7[bGԮ-KJ8. ҭ 4j L>կA!t&&h42{C *fS|;e @HsEimw:x &-\]#6yT0U 孽 ?[9⡒᭡#wwjl?mZƖ6MJլaJJ-bmҜ@ED/HV٫]Q3ohtʦvuDWيT%RSFyiZhF[L~woqֺ)li$ĄY)d3vkTs#oφMz?Ev]\sȸ+ǿ+K/&>IN{f-sx{bߧ:Duv^7@yZ$M 5}TPEU"*s8o[qË"Bxy)hR=^$\?ӯ¬y ߜ6FƒAG…;pEm 5וC3\_bR|\m9Lg ~6VqLz bT'IהT >\OӠ{A}ƈh-Gt>0<yfd# ]F@I T_',8X1 db9y|D;jL} < x>b~OUmnIyڅ7 @!pd C @[m'̶{3a[-2ew hB@&$2*%jEQ^Wx'hOeF^ \Gs|^.'iJ8Vpގ @d:!gl\|ޕOAW" J nڕCvH4Eno ;.p:?JH ?ZɧOQP)"vj-MsI\ 0t$>gj|hEʝ_u,=}/nU,g{SZ/ǯ=R;m3221.Y!F1=dۘ3l ݩWUwԫQTa=phOx|}+頟԰@<B ",0GEĆ'cٲ;ϋ.?A\p[GmxȢ?7m]t@=i'/ҪD],Պ^C2v  ӪiA#">!ƵF wh# !ķnGvRy?V[F]bI{]?Za R;_͞em9O%I9wm4UK =W'$!@vdp^:8,giJF3{iw6s>Wh]&<1n|Yvg:jqghVÑj;Ώ3C-xOye^}Yh!r =  => cH3tz+Wǻy4h$NbuZ\^'0cL~ΦXwf@Ŝ!4j.S'? \Â9H865ǃŽb>> U"{a5N1a9*}WXͧO9 pULjؤ") $P5('? ?e:Cx=D9}> 20fF` ar0+=tgM,>-&>KXXa&n*'_,&F(A? 5i]/ 0|(MYBU(džXE_DI OkĚ4?pscq%Q_+We]ʬ<3X98Zax`pdzIQ0uHr7B{ A64Jp "{oOatѰO'{dd# ࠅ OiZ`<&oKԟO#wȡ_ QOu+do`hw0D2~::_{v6TzA;)>-y3!@vLruH DCQ0 aˉJq[h^l5|)G\Qz[EG|fc?/A5 |B.0]G 9宯nV{soaLNk?bm^#яۃwa|x?-b?,_РAEe (b(!>8?^7zL_]]}曫]xKٳ~ǚd|߹x0ne~6џ̣0Sw\\x/ʏSL/r ` 0W+ʭ/9[@5-e^OQ~޵as~~PzO#$~3o7m% 3lbJRXR \9K" !e bckwP>%42HgZaL a]Vi'79P O&>çIGߦk8"t__AأUl$ГjlӵRY Xp'1 *`.b ,-贡j ^۴,Y_㧞\H{]ۻRfyiX02o{{oBY @[9HA ^8Ot(0(mJh@h6uVm~ 3;׳jumED/F1KWHdQE]&\_enL2v8ԜVX.\ϯys^a"1<< ^7͹8"8W?:: D"?]wLK=v/̆jboWl5WZ` #?JH %2G cfί_G3n)\Eh^"P=E?mVc3Hf/&?eW7J4_6W#jzP͞މ2݅*t1`SCˈ,^baOw|gk;aMQHk˕tV,̆5`;8 TPd̲B6qn8Q\3O0@`}w'kt/^x/bc!HD̀(dE'ցt*)k+l3S+#Dw|q6?+6|#sw R+WD?Jۻ!cހ0'Rc %<;7%7"/]4T7%vB XMlY!(FZſ٨R'u+,>N+ll)qJ5~ө,") D%ZV|ShTeZD7ܟm&N1=2`fcu ~,CmS"7_lst>Gn8nq;禠,qy 4%D<$G7v7r`wP3'[@?S" (;AoW!8^;4E2rC M"cpxECn̥Etq-dj &ڜzs*'rҦ}nu yT͉{7Xڞ)YKF;*A[Wu*OWo<,2^[HdpЁZ;͵WGt3Ż+C27t커MN lG3 ]gWzcZpLLuF25]W(= IdM}@q?!-`:7.3޻Nt<%PgX.ԗLmQ9MY~](+c8*Vk5j4tyI̱&՜ی:u0ݲdsP#n[kp'*ж:Wq54ҩ>ƣ,fؘsV^5d:_1Ape;n8Ғh O_'x=)` yV"َZ'Rq i$:Slle\`w۵D1HS;=?AhHxjo}£s`N'^﹧4D>ou0@Û5WA?:f0Xc5JLh&#)ގf{r?5^+k{ dbʒˢjSg*@\IIkd+n`{;Š"\^B [-;BO:uƁ`5/O8ϫ[k7VSUbxmdw•Po $-H?N D>LPFdr< a[']L_aV} F=ec-6K078k*TiMfK:FYQtHa$ED#xnD$;5vL[6CNqeBW@RL/4Pbag5*#%$W`& EHja@ /Wr-+WD] Mh[̍1Q ()w}Y:HujQ!F<4%$Ա *Zao++>__KA0\pMHs% Zc!5>Oz+S @ǙϧʩvLT{2O- o9|L NA~o8(nQpG uw&CfҔNE~=*ؘWOerbNj"Ng8иL8P*\~'Y@ v|OCJ$f/76B|0elcA [H̸7aFt^^Vc75Fgf[\޼αp<ٴf9j!:A+5<"~Y  %n? \:ݕY5fEuv4"ӥX# `̂G!>li6򹟤MTԴzv=LGqۀӄI-lɮYcˋ&&j3G?q9n+laz鿺ؘ*,Ai-PZ,ʴh'iizDQ۳`D pyKA5q[I~8o:}=PVV{ mUE|n TM%a^HkjbOMK( }{F &p?ֹzI2мM:Tn1`V2iQ.W*GA\K\&d0@{máT9uƟXǝ J4n`xd|Blzegy|Ffߺ{՚ ۨG1ʀng]F )Exmr֞|a^DZ'T=ܪGN!ukZ ;k\q]Q( _dz2Oaw{>>ګo!ЂH%;Tx?fY6 i?AOSx/YNV uTdpVsEl#,&JZc;\}Y}}~T"(9n&hT&$^qsXe dSd #W4{-T"oΖxk짒T*gzSBPZcXpM=F-Vؔ*O*7h"tLiw3(d[:̚$7X>?^n h@6i\PRPQe@[eJH4b4<ɠ㠒pKW.&= 1@ 2s<.dn4L?]`>&Ugq"__c_XҌP9+:Y81Y:ϱ/@W 7FR#4`c#emXV8Mgsr |ǕHp<$`r1# 9qB#T.W3+Iڱ>L5#>%'Pty1ym&e3:~"gpkXK#)*kcZ4N`+{Nԟ ^KwS~k2tS-G:Ɠ3RjirSѼoU{ 4A MB sNbAhhWIQ uN.f0@#N@ԣ8 _gS_Uv@~.,|~{tk/*M6}L_฻nՆx?ԿDױ9N̍VaM֡s3Yo^O /;eܪ Df@|9J,[m 83r=8Mb wf>0#Ƞh A9}EށYD9K{4?r; v U1Rs2AOx\%6Wnm/]6l[OPZ\{ɶ_B8syKL-H3sLikVUܴd2fw?lC/g?/ VJ9~ҁ;^1I %-/Kxno?ûyCz%/*ES1gra]K 2"́K gryowrO vF( .4l:x/@lp֗0W!,PԌ;H /^IUp qagz=6[?aB()g\hRz{H| aLyz_`Ej8IXC. )3{ \sՔ$t4#F GGC`B,!'֘Y{_D@fMXsuAHHN8p9 /a5\.P^o}wO90m8cQn^$@XF',I 4,k VBqmu c΃STe{Xf17*V$$3@a0@Ŭ,A|wYV r4 3f `բEmY?AaG (vI(FK㓊j^8Ӄe,iř!qJ@?=CLrFs@>;Rq=ͤ?e<FKf|;{6rnO@rs9QF!D20bHhs?g+ pUnֳbʎYǦvF@#m4o櫔$ %7 H\9kxG=4{dC7(ɤ_VyxM5U%j5jExdiSsHȫVF5O=.L@qЏ0O$\G|fk|+NLd RiGgCqh]N9.NX?_ \-`@)U BZآ' 3*bmH(PtkmSfYVyf.9u 09z$;ݿl};,)۬:,:Ԭ2 _1SH=}b*+O;(%}ڀ 0|?v|T9({qz0\Ъ>j}_ vT'!d߶K蔷O(Zax:-oPN )3z9K*bHb @r|.&14T]O=Q`yrJ NHopԠ5ިQEfe)4cjh&{aWE=tʻhɮQO)(?QRAC'OYoyH~ Q s띛=^p 1qFΪR[AmPQFnVP(hЖYy2P0sYVފt-.(SM27u`zkZ%U5Z Tv/CcC{=na4tr SpPiUMJ8ws72j@IC^}ZQ0V_ab6'LOց׬v^ZYܼlh,ucZcR?Ѩvk'eܕ{_ͤj$6Q`} u$7ڷ`>U*R:Gf|IE4ʾ9APzX∰R!IE52Zb~@@9_Aڴ_;@fBt*a ml`ʍS[)JݢYu:^7FOq IMta*cu罊Vu۸cXzt,W;Ç̭۱] x? 6x@,q8̙h\1psyG"ytj,Vo=[qw sÁ˜Sv5ˉ~ԘEmʗRw_ɴ>n OV # @/-p|u6SqBn6;w»EV x.Ŵ[ymd8(3jd9$Oc2`lhh H+Ihp(ɛRo0l>gR-.YhIs-ROF-|x0[y/NIOzb0s(/\nCr($c\uN˘^z@"150{F[tξ+ Pqkbֶ:XŢ.9teMх _5 y_W t4}>bx$,~6)@nB.z;j;`2zQ}d9L#~ed^lug!["eJD'; =ɥe>~A)D(*z{v],KBAYo;bZ.:$aGy2:-QƷwG ʛU1!mz~Y9 ZgolvLcb`CNJޛR3;MC|9Pn9C_ - ~<4 jD3?V*02' j[ mR]-t=AQY&Ա@Ͷ6WZd/*ȴSx?N,; f ?VmW}u}zgk$%D0n,!aY.1 8@@&rۯӝL(]8 `r^R[=$-s[#әh!n6֣ Q1 q[k}m¶H}aD|y˅^5sA4>L*C U5|3."~oGC^ߜp:Y,Gh[ћ7}kb!:ZH!W"ptH֎!Ϛ"fE(e] o]*E6GKMۺFkࢉr`r¥RΆMCSm^SRtۦl)dKQk1bЊy ͇jR˽%bJn{'$% ÿ[~תW"1+F;p[(ɾHY;# [NU>q-kϧNQ5'ހ!+=+ 7}|Q/ŢbX-p%YqlHcKY5re3Pv6H}+q7/ԶV1iPeL)ETbt {+8ؘ{F@"T{241ll0PSs/dd?%}/R5. ;g67p$g:Zfԣ. `=]|An9Mo8)AYqb 4bQAIDd =&>z!U՝`Klui2Ң](?rBKPH6*5savLEov^]xLa]% M{'dXKл #Y(G6Urv8o+wu&zAGJ>t>n*i g&rC @r;$ӕC-o, TvL'v8 tݓq:ܞ]`~i+U)!IX֭訬lߐZ$|=AZ!z]1`j pٕ55J Y_(&P?g2 ܗH Bv%>eEs*wE9 q>WOkop߄z Wp- !7tA AG֚-f ⚴2 0e钒tftíWY پ_9FhRGG ?]AUQEX!x(82~Dk.6UXX2(%PmUUCUd\uIm&!,2:A~1/eέ۩҃33 ((Cp_z||{V!9D1]i$K 4ȶH6Zٳ%j֬}Xg~Ir{XŻ-%Jkg0Q|W]FZlFe1?.1MYm?m8G'>! C1?w?JPQ* el<M0J4Y)DferweIe/ԇ*AKćB*@N&X6΂B4]1iu%\n˘,q2Y 0Ih^na+H aICv|0!t֙I姽/lj_Tw i|?f_;~vXBR+qc)~5Q^V²UYKn*V%A3 DZ5,WuPq0`%t(UV;rHiUE u5kl4 Ef*9oowGGKb*ku(3P47ު'--|E'Z*vɇ?qjTB q?6_'Q {ږ! 8d8U*bVL~:ҋŦ^cNo!@? Eƽq>SRG&$-2~+A)=2@-4g$i_2TX&h>G^*6mX5(oJ{ʋJuRAqK딼E>Vˆ3J?5;FyO%ȸ,e28KGK"%!B]Lnr7'nWk^9L~]fv}֗j EigFK +(4uigpz!]Mڟ e?}j4<4))B,B=!>*:KPGܜR.t94 8+NW@.AJg򓺻VR-]`#RK (ëzː$ }`5lztw )vqnV[ ,I7%~߮a7prxB!,0@y䅃[[}w]C!zz:v}iI(0P]q db~>s]!A~Uc#*e'.܎aF:ZN|ouQT膅f'#8iℎۅoMCX* ?!x7yo0as" . [ jC0D{/HrŚS""f) lNQ[lh1^5Y'Zc&~PH4!(:|#b1WJ]7826% W-'W6Z7oNаa+bf rg$e4?MF\k 3(0apNT5Wv~KeA-{@rzR"xQ%=Pތ*&@Jȹ^. 3;cȉWN-XWy,9%6DC^> +-kx=\D2T@8L-%n^޹n C{WAF\ڷUq Jtiϩq?* F("䄲LK!6]{>pKB""6$V]2!1K[?b`61$hRxtʐcw{sٶj}30 --<Ieؗ,}ćKәHV:۾DJRmnLKWYs TIbqR񽄋=KbуM#NyB_m7W>2Æ@ $uo P&o|ΔK\ HN(4\Jb+z L*A֣U>σ7uo HЪ}B1{ZɻU5{whCF d4}RǘHW5;嘰y@*^JtY͡S`<g#[,U!/_1z:(˳.B{Pi̭NBJA9DRFtla5X(0ke]8` I]>kkQf]gY0B'QƷ{jd}3K6\|hSi~H@RJ+Ӊu r7u]N.jG~e,*qM[JOlŽ%].>GapB\.Xն=GekIwf+bL6ho}1nx;I(MVf._nFJ22"*NCr~1|74dlsUn>v14IceL1F~bF9(p 0Y"fj*k jzTƑ6ڊ&iQݗ0Z$Z^έ@INZ8<ɆO6l#>^h/C6[#9EEIzβ*>󼖸UY6Gaz JCF э#X+jjgqg~WDgSaw'Qgq89%AL 9ZhTHhNU~C}#Vi||Ϳ:X i/R7k)c3t0KC|k-S#] {'9Lʾ:[S?:5@| PHkh_7(yvU5℮qL]?QGm-7(N ?ҵll~Gyl̖ MdYN~-~d8T\p0dQ u"s@Pr]H[ 4O3:l$+gfkLJZpQVh?h{!oVVtJV i. Uٓk<߸q_|J4)LI6YV @Wlg;iviA [$Q),FL,EmUY6_^c! hR4 PRzIY7Ai$axLqAB%sz w^?z,T)LAgh\%i­lS杠2tMu$C{[хw!́p׎#g`oۣ #Ȓ<.oOo{Z4ô(♺z!rOLG7x^/4^Q8T 輖UBt)-0B!yv}?V,ׂ@m)XoL瘚w7hfwOFBmT \{p@M3Ho&x2EP?$&)txCh$}A1X>u!}]niHbp7m7J1j0*HkBHEʜ8+JDIĝTgDyB=At1`KnB ;в(Dt-'q^F",I x{]tt4_$͞s-=^sHn?ĠO4=#/pKf]y񇔢WY,`O#cIuQ>\;HEq+$Pcˠ,i2e/9Hx<6lv+T]x guv|0rtvt)>DJ ?B0/9Rn&gr]M*u]$BLMuS窦| Ȟ8"HO-bmR)MZ" `-@fLDE%**E`ԟ`P1{c>t0L.`ܭQŠ(VօҐh ORاطTڡrqQJϻPcIv6dHYߴ0+zhSlV7I=o㕰BlCo^8ZϹ?̻nAKJm@@ zE_tnYk$ƞ0`9Il }<}RQkW~=jOmVPOۖBį"Otr5bdaL/oZ ڞœ9Q6 Qkv%: ȇv*j; }}7@ IYOCyo_kg~,:c*s-YcTl,rբ Q SO *A8D6Fk4SDps)uQhI#or94ILhf%b=;"tvm2pָ~*#W3:j#@.漆P0c`AŢE0:]*6vyvZErklD;_m&twUjayE5iN5u6AwK~\^"4 RZt3j#08JN?L8j`zwየ[,q0sч}lq;%A8ȥzzyD8Nz7sI_d˛Jz7m`>W`$}N sM,G*vkaLIaևR :e+H8Bxy{j ]^HcAC~&@akw/rc|&, (9G^h K Q-Im y#Sv$DAL5-1BNZq 7 Cr~_4~$Thάu0c /l`!l(-ʎ0ɰR슗O(á} ǀW`Bop۾Ø\ Wp*CN-co\9:88Gb=qJ)^*_s2Y7/ELgI_FXSՐ웡HSx=g9 1r Psp2y~h4u@C4|haAJ[߆l'/R+_ j ؠ)nn70ِ_y$Wzp2JcrB XoD 4:| XM9wm8 = *̱>XSL+H|ɭ42eyӬc(d8|κ11ٞI@R :N{HHOGrqf鐃Oas4 ik-mWJ$\שpW;nkbʪ`FEzT"-ʹ84vTE6M'4:HE4ϘgRk8R\tP~9E5+Q`IeY<HZ,gW꽋 %ꢻ55?0͝ }1٬CV?!3wʬ{!p+Qr}SQ0qֵm4שiTm(zX]GwpRS˜ ;}4# "`1Lod:I+*w0dL- [ͽi+(P+z]]t[0'AwzlE' t'1"QÀѹLp(!#ajJ~ b>Ol5C_g"&\ʜpvG8iTd<`x2ooO#ئ ۔`~,/zy68KFbͱCa+|Rek_\7sbGK d 8[,h`3EVhT /';vHqT?&3aRt &4$܀t9׊cIlfx)1#kCPgjZiwpkv8Som JcLː|WYI}aA4簏AEg]3P|suGaW*jD_HzqBmM;LWzh8K))rga3JQ] fըgl~( uҕO(s$iE$ XY e{d{:V6J&m6ʋ}p1T"A H+%-&,jYenc\d+ a7){>7Tj$@s;yKdsR(Nlͩ~r/ecI^P!/ `/pp)gNҞ:f>ˬ-D$Ԓ%wOL~dՠ7eDgzɩGbbvQ$>XBNyMv3VW҇S衘{ ݃@Vx7Ń|SS>m>K2U'e,*Î3,0 V("Ӝ͘-׿"ed~ޗn.Ue"(H K_5ϙҕ^ћP>^74mjKe !~y~ u=o4˺ă9 (MK䒮g A6rf6zDlPB`r/B$=AbT1)&ZXWAlV9N ۛ$ p)SčI.=ПQ 67tE]nŰb7>(q? \&u3YVڦIQK6 JD0#Oa RoaM/a1ҏl湙$ 2zCfEBa/ 5[B"Y+̕e4_$sHaF%]d |iIq(0ّ=~qˣ+ęOvĬdg|jKcAqmRbzO1VyF_Y{y5j!>AgcPQ<èJY|2&<𮁳va@ބ:>E'|fhI5rMc_G_eC Vwp/ƜQ& IoYefz(bI5* ~ mo?ˮ$ʀTa=$G $'hp6guTjOW>,KC@m6._;]' rr!8B,/r4Դ;m|t'A/`뵋( cN!F `c>`Ö4Z$U7u>b"ţwz.*!E"cJܨ/L>'@^F-rY `lw>?YZww}q0L wgJ@+a{z$д9/!L')߹YFq;妧sLaa״76:>y-*qw!kα/Gf} 1oE^,s- Sbm0)JCjk4EGpji"9,s` M";zQsBQG̟L= a-N꿄dF)ĸjl EoPe˙S klPDOCf$oV/Lh*11EDމ? m#Y#uFƷ#,QzXD<σ8\ jMڈbeX9yaf HI,D{-=ڳU<;k?HjMH)w"Δ % pR&eƹkk"g:X k*GơaUC=lnѱy]o ![&l|8ڎfyڊ-qe8!%[PH 6P Nlj8>8m7O|YkԒ9[~X3Qufv=F;t}.7jQ N}!xV)\2%*>GJ` puO+pG lii|% dpԋYC0w)XT1d7EӡK6$>pY!e$Ng$ݹRe+/{h#R Ҕ%"kՇRcbD" s-.[&ɱ2e_ONdCW@.ޒwGco$qdʋ0][TdGgd$>ͅx+VS ܻy3Vj_XæYSȱmdy~QWe?9V̉bN ,ahcïׁASsJ_p-%_!҂|:IUږ\ea/4GS_Mzb(FF C=W{;EM R{SjʲX맮J zaI9a:#yB`])M3˝E[ V՜HQܓ.g6^ GnX_kh|O#i. M:H7C=zw̖W;5|̀ii#kBAV[T;S5FXF@ol\꫈ _f‪9鄀AȀ*[NohyA yJ~ETOyq"r 9+[4Y]8GR/DPڍ_ r߾ /;@J L%u nCDr/bV$jSV[ߑ͑=oj, z~P;9?g=(\ H2)H,]37VV:GX ̢BI/Y#"msp$_ȐQ @|}}keIQf[qwvғЛHq C/\t[`Z}HdGUh[R9b @Y`s Pݴ#1zw_&!ATR@>sWi.[Y:+gNf 'ZzX&A@ų6j֣ݿsTOYƿDlWJgY*#pH6WSnb% +";%_b%c8y2%]T C=XHN#uickbw>Hʱ{&JIN#!Ij[FÞ fϝkWe1/+ s@~DfuU" oV\"Qq00i?VP/CdQTloTkf_[$ ;-؂޷gK{\؛x,nc?զmšuKZ s0\|^Fw)LH\ƟP>v; [lO `%n.$iN[*]1 S//'J6*v$5wp(i"T>xoUlCQZywe B*(%{ZbU@i"Nuh{Z1*'?alMn=hyGw6mD*)msg1y ņ1f1eב0 :rdpOɥzJ5qP\,\^>"k%'ܮ %Py9-7@{2ƐKPx0t_iB=~߇в Gfj`ݭ~ ##_' wV}UHٶ@%]y.QHZ,f "EErHgh{AgKe˄fi yņ#C4rgSmqU! εU '@\a>-BI/*JTd&ځ+V :D^, @5)1I18AX6(v\Ɣ h9n>ia'knXJKX6 b*yۗUHyLPZ#i|ʗ`Ar< )Sx_?d{WA ;m-?& y2L:gŰ/GZɔ()S4atrQ!X6~4^.đj;e_=S=~݄Mu 2Ur7p_q 'cuN?n~JuUf=Vg̠L_.mQuD#|-F5Hԇ]?X!k|K#;:lޱ Ii9T-9 }mN}/WM&՚jŖ.2֟z7?4&ADetfvQe|VLhNfV =4w)EH(/&S]ff[2psn/iR{w)aJ?5eouTՃZ@7kRތ QXRKHk̺VkeRUH`fF ahaMC|?w2DrK~!bJN/i)ҴQTo.ۧb];+.eH)mrýG$׺گZ k70H pPqm l잞=Hv|X <` =S,^;lW4W-7NZqIyÚr+lⓆIqh)Fܦt.3y9&zX}c̬#qa(J.$DE͹_#A+=a@OA geHp].e7@t7~e78"ExɊZϯ+,O]-fPӽe1] i$E3k\( _= lbuǶ?L{x#Uw$8<1q_g{g1>ro=@|E ѿx!r z2IB[) ܺYj;mLk?n<9=W_1Bd`|/Ns/5+: 1qK&l_&K T'J.ka1]xaRZS̸/|=s'޾e=h Io-~@4}}ٻF&#hŌñJXУV"SO~x J`H$(u7~rT>{b2at_rR$'bϸy}l찵#0VɎ"eH]L7c{\e5Jß !ljH$#=މQoi"M#fQ^v(姟rͥr0Ne 2N%+/ $ufLVWr!']%8(.5U8'%;(*+V̆]8]<[tgYEy]o)G:+F\Ҝ0#DaAx鸘"Flĵ1?: v#$c\*< ßI#&:2wlV<-mE.$t`w'םs-ƪ3>d7U NwD  Yr)(8qӽ0 vDAH*:MQn׺ڔf]Aj&xxUZw!C)[ /zP1q17YD!>qn:)!Uhr57Y pTv'H^yQ:u3g-pF15D=bKל'M:yr]t K?)7ac9qY M㞻!Htm["Kw5x@ǕaGJpJL;TU>km N 80F3ﲛ[oc.[Vyc=HiAzբT(Ej6ONb;,ܘ,.}8<' Mt <&iy%iU/J!;qp;YM)/x-͌)F[EQ#cxJ߂Ì8Ygq]P~xRDoLo^UN;Exԧ^R$2D* [fh1>{TeRig3ޛ{p34n(cm^( e|,{aj 243b:K˚#2̺ ֤egѴ@O[Ts&خ"5r'}_uW}deo)N(> Oc򛌬0ߺv\EU0DƐeM[/F4 .tf@}:2(fҫ.Z0SIg&,q #2}yv##a#X+B9=~; CZPo=i Mu ZuR#aW%.땠:i n,E?7Q*w 5a{%)z+}K#ȃmjD/OeҒu\#f( ״";dTdCMGS#UIBOlQ,̄L`=n9,3X4%% K]͒4?,k_.}z:? ƴC(AHeUDqۨcP!. "a[mil)g浄A"GD|0(] lCPz}7V~x)u0&L0L ȜJˁuQTB7xa&c_C{FXYB:Ѷ-qksҾq^]qVk`gN䬌*=JkI,͑O xox`ֻ0t->;d=&ʗ=Mk\{iKe~xNzF;-(gEekJ EZz'ė"sڥ07iqCG?PdsʽYʔEH|Ȗ ΃_b/jR` :ϵ>g[Gh- Pw^^XH2DtBO\8&a#5TPm0σ_uq2qKc\i@ItHYo()aښ4#dF|X1̋iM/ 7Bcp+r##نm9Rɍ5vJV#4"cf+O2_ SY߯`KYaŁg݀7|CU5;oM n7efkcFT ij2,H6`'j\-UHs;D_P Uĉs c2 rK#dj݀"娞#Cj Zxh ~@|,?ڵ/v[Cփ-Y:>{:x?q[jm=p ;ŏg8?\ *JD)&^+GezutfJ>hs] LpO1 Jd'ъ$l%tvÃ_I PJ˼0|1UFvc9RrQBUꖮ6'm;b=(!S7@!skNfn]wQUzhҗI-jM!v-kNA:̤'Ȼ±";PBF|% r6{?g 9'Lc87U@sh햓-3ՠ0{?j"׶i ߆/Hms>X{[ *̡6pq%5_ sɈ >awEj6׌a$Hwb< xiKC_Sq!thmTScD1\^\XEyQ]K++?h)=&__)#t@>y1ohlXST)[N~ 0^-6#L{0sѡշT*'? 6*s -7''0> ⛖6{VG, 1bdo塃ht!]pDԯȠ#j@e? gb7s|PEALPfGۊX\Z@ j Kr{?V*r!VPUD d'@5rrGB ˣlG-(jn27̂Y蜎DR2  9F: 8=ȍln)+Fc-URxOuhT 6;"B[P}dCtU1Y`!ȽPȱF7x7I|q(vpDmq138_1k6̥kW[g{'_$▏%]A|#ߌCa)M6 a)7#VI:x>hv8p`ܒ NE?#[q.Ԋ#mMl"L34Vj.0IfOO¼Bv0EN=jS8KFQ|.#3L,YZRB5dž;ڔ@TEX܈[3t]5~EkRI7"TR;?C2x&8cȅ3MK7{oB )awI4gI+b|B߆?(<E/\!]en# Yn%}"9LRZG?!NE>RWDr#lap=l=k?y9kJNީbS&LJ7cpL,FN0T6Kl)/)sy-L`Sš,u폕 >xEaq +X~ -BJ w*ReOպ$>w"mb1Zp1qsI3ڥu9pd6П]WBK9LnoFf~]k 17߸*j̩)>o=`MOl3G j-s0_LasK]fyZ^UJ` @?KH$R.McOk C{mֿi6w~l kueM⨧a+%h$@ك'6!XcO }لF61k(ݕFZFЬI*n7'm ѰD,S'I2QA;и†`A:X'xĒn4 WDc*,pѪll2UKA ` !!t^eu4&3&=/ψ}$ڷ' -ri25ei7[Rԭ!A Fy8φ=I%}']̲KCz7"DiuX1f9>-C.\Թd-]URel3qS+,^-h@ٸ `%<lXz0. u$b;;/":Ԙ{h{32r̜G%+^o7E|+E[yABrC[nQIf}:A|94 k: _c*7a&1 Xݦqbs⁷1c۔Ad\OW׷]r;ڨn6.I{Yj!堮*[vU̟LX_*.=I)4;@aGMc!xg ȑ͛g7@5'ނ6Q~Ip "J#"#:+saҔbSJ T3K/7MJ VSkͺCQ&s:x) 6>Sʟ"~ޘΧ{=N T1^@3dZlZy\t3% [EYnsۗ&q4ߓB_x\!v-' öOV٬?jdOfpf DuFh_ CfU};/p=̦,XQ+cDvUf;эD^ Y-#q>%e7u(!Z.5pG/T @00a,^ }(% A4m*[f|>dxg!iЖX4b>=x2D9 }:3PES;˪QƇ =]7\oXxC£ЙW>l-G ҶdU?ťX r|gD=6Yeb-ķA<ȏdvhS/i{܈0|w:=6c@ ƋbF |vֵNrI#E ekEӻY 83@ )lc 5~ rp.r<6":ؘo$ٺUD21DTHu϶M әb@`&R{ W"hys{=eVrj#ߛ0k3Kp+ʘV9668]1P82²AעD68~07Esd$‘۟oTQ)^z<$8lIs'm376߅>c/hK~*7]ʇO+Joho<~(IuB$a,$! oA컌,+5FDLi~ sE;bL#δ` #T;C׬x/W²<-Wǿ>/ LQJE=\Okn}7õ5bU@L8~egVB"bנD"}v]bXͳ-T I7 {i$"z%%קtT:De($As+6D…07-0ig;{;()~xU$6t?X6zw~)F=ȾGi2G3XVHk}Q$apV|:pV DSpakJ3Wn e[&1\3l4NLJHqn6&?iէ&ET1q>5zF8<݈Z1wI[mg[kfp$Jf@Ɇa?I&7;\U_{7ƏuX^}C0x֧V3X ulvW)ϣ"0Vm4y$~vy * ~:Њ.u;~# ݃eĩFFg6OhJfr5dH%d?nM]:JN+EA_o ]ȥ²*[_H:{NCM:(k$qh|$h{OM+KJo[F($s(+ܓ& ["ܪQ"PXRIMx7[Ut ɔE ]vw>Š}.Y%Ϫ͍U%+JH1͔LZׯqM+/ pQ 66j! 5Ǔn:)mJSfxܘ <^Nto$U$AP,͍N䩵[0`Jl{k;X "{pt(J^߽) i /[HRʿLPۨ&RpW[ i°1Xu֯uDIL4P=n+j_gk{ O gd%M1zIF:+C41s?ẋ΀>3^}NkM:\FQfh|! `ֶn`{&L VfqA`ʗ!_; /&M~Ank .U2i8x Utkckמ8I\_ Y>#5GҸ&CfſuT'+zXS?%?^}+Ғ#NMv1N&?b hkbT{dA,5)z% 0!k,iuytXa"mn\S4xvyˋh3Pdwk5?$і)5/Uҗ_(n|^5G# ׷Ճ*"MsA_IDy95![vb3p0>@<$~`doq_Qt4S=5v哅pUth}*r7T䝯*;0$4AHF„}~ %1bX 5I0ޘPW{֘g3Oď(>gg}K_o'@έJ|(Q[yrQn{|r_dRķuu)zL} fݟ1KZL-#%6M|<ҜXQQE;u̓)~*:[J(P䬰D移~EA$܍R{6(֡uu3hATeҨ|Y)N;m,;G{Pkv'iJeſtBѫ)|PHuY6JD/`;G pw<+5X*tO)!mR!7M~zf0"1bc}}P-o;d_↠>BqRC5 vĵatK3mIg4TA": .bMUQ[rͥeȄ Vs:UO*KT@yMn fdpo9Rd9zMm@X@4~&G'JV}l<%xI:?ueGA)i3A,Pny,&w~v(SPZHU2E{l3P,9rTt,wٲ s)t(AB];+aKʓS]H8XDh:G)'ݘT06Ϙ ٛM5BDۅqe\4)cJ%Gʜ4@#`S3 Gkeym1I wLAh̪a~F(pTj ʣQ48z^_n!Wblgh] kye2:*g&Z?w`[g+7Vx0(FnXbqa?%k\^ؒ e58隔`R2ЍxQI7+sdBgv| i뭞YҌT̛;g\V=?i#h}Hf"ũ'HJ4[5S-wG25e3c;]:IQguUqzmi1Qz9jZ4q1ܬAζMV~"7>ן9 s;H`%آݔ)<e}+ 'nF)S<ٛnK+I7lH{ƾo#eFvHOɑB2<3l}3YPP3u ԩ[7dگB_){XU MbnMX -'|Jn'YO${*={Nk7n$t~!YR;cQ\+E8btVRfՄ20e-U=ϩ(PAmc x⇦SjW} KYhM)̋My=x,z2\+`uuXZcs;?.-%=_8 NSȇtSBID^KZ օ09}qs/`t1PVXd Kolv (CBW҆`6@H K5/Kkp`I7K?5c$wJ''nt 0}}@it?9>+lGXtظ0U.~Ʀ7g^g !< +[*RS_q+CsI?ߡ3)Y ŖHr縧kbE'"@/競xq>V$$zw u'%qb@%0 P#zb~ f*][hvQ|k0& e;i7ûtW-Zٱ,#^0q;kV5tWA'S+<"Ѩ$WOm#찷aL+z Kt:_.᩿lЬxW.nSSv r od*j`)F".hQ ZADbx_X=?;BEq6r.9^䌫Y%ӻ(1U?/ K:|`һ5m}*dm=,2*YN yg-s FXNlTCk6 >sFDru013PFSSRBwc^kEYm%h[nH+?SY{_+0E}1~q+aG7 J32&}f_∜1IdCexNe@N w #&xuv, z d=Q (RF,Z$?MZG{ zxa 1ZYmj(Z|:FY&p4v*K9ݤ 6Y:|BFv,g3Zm޺{8C)xCi8A^v'y)uB"A!ޫ(tv. n[i!IƸYe=v;Ds4oi֘"}Kdϧ*$t[U o1jj‰x3}J " 5Rr(g hg+xlg5W0dL?WrϟyAWh㧦Y7=/[@w ׭.(O ۇs]]C2[%co lv kN+'$]ÿ[,$L[ƨbWNC}33;6f QʞX=.j94yq3P]7voj?7J2ŕ"n 괚ݘ[.2z|1q.ߍR9Kisudp1!s+Lnn D\ˁg]j/&M)a=7H~]&_[6ek+3%rJ^׾`ge=XiYCkބ6*l43>Kz4 $=H+ve.(B.3v ŖŜ\ @?U-Q+|{vs s3+Dsv݇h5ɏ=34b/޷JSid{yY4r]AQ׈ͤ|(حNNvT\Z4.{ P! x#8ƿ7u w֝to֕W FKͷa@Wp ܡ\ig뙿44 H=4VPm+A$9oaBJJ*|\t8DŽWj\yHO@:0P-BAj\:! >4 y#pt'U>>!iDqFs`wa0(=W#b!OG봐}ȺVA/e'*7̖`pD!:bGoN>T-/ ;{[˨`&2s<&)@wBW|Wd!hԅvjr+E)T\7j5_p\H #"R}eLIW m]=Q|VR16*곅"I{x#9;K\^e7P!sW`x/%y"֜jYH̋y%5D%/Ƅ8^.z_*͖V\}{V[e0{4mϗ5Nq@Bk7129cy7%a?IaE]zjGF(RoytFJLRa<$72GbS{Lp/- O<L>I,c52c`PVѝ: "R}Eߌۍ-M_ޏ$p8ҡbQ (ivyKa}C OnrRA_%;g@/Dˢ쯸He3^"xuCo[7:~ 1PIz0}}(M+ǻe(`"4֍9,JӘaaE_..ePPЪY~ygJ׭4eSؒd ({ڞ\tܲ?nA*Wuv-+ƧDrR<{$n9UT^'0|X6%YV̞Tq!1QMh/Yc+qx3:O|uUf6-:5p&DI߮A+C~^ﻋŽqx oyL=4J-/&7ƙ#Gs.8=/8 > ʎMM|U0$`U1)=I+BC0)FMY9)Q7A-q=䍟ь6ڊSX5q A.{hHNd[%l(WA#80 }i*g>z 8JwU[r!2eu'p覄ek5_Nu^d[տk^x|VCx Mٱ䫥7 6jӤ"ХeYZ^yL ݜitPUUd!<̎.!ƟÕ&gf^9{Rt?mna chWV=1XW Fa# cYJdm1-tOK Q\΄Qd:sSNz֢|6 Ღex4fI*3w@ZAKn0iC$m*g}hf)h)-@KjUE v]F%[i8<:H,t CA"'#@} X&]T'@qg#+\ů=)_5A8ܼʾ=Oli0k(3ViD@ 90}kcNpso.}JE _::Oަ}p)94,X!2r+ )</ZK#=,}S5B" Eco[Z?et.e|+*ԗ5dҭ8.ѫw>$% ƍZ혳#q"nwx? +fa<[Li6FXRk[*ϦqlÞdT/G5 .^V" _"t|)zAV77NPZ ]"O ,|zWSUGn%0? EhzVٛ1oHPlLk$N*qCF,J1)*|YEpzǑ>Zެ<-X^-@9:K&a}Lǒ〈ڡFBUA?n %U }•i`xY ڸB~۲c?3eJ)zR.0M8BΛhVcnp3OTvwPJGir"@O @P%o{%)21EzXq?A(*DqU{u :Xgۀn-yI˛ܚӶWdNOeb^j75S$L5ݹ;m^6#`x pLTHOK?G7`=WzOX &$I+Yš-q:k!ɢNXZDJU?mvП `7qYdX °yl˶"@7[wur se+ʠ)NuVhvAj"Vyytn6^d"䞲 8\T!8D[V Ca/~:O|4<UL^tV:d$V!#~qs)dz!JUXdbP8-~ H* 0hAg:x- ֩ &ԗ`i @ ѕ{mg(S+fC=zLwlQtM n_/%D` }ݣ ȹq<E2F|nvc,xw!262 a=!Q&f 2h;&YYA ]Y]3]ŧ]̾J7D'aY>b۸p'IEIYo$̖ b&cFk"u@~D F*VodaYkЛUKd>u7 |\u* TQBbgk1FlVuOߐ**yn"2̎H\eڃ9>YnH@{Ba)s>6:\ 5?VbS9 Qj37{C/^~̍פ84kW\:J|\%7B7PEo4oܱ[%%fݴoJ>zZbwSIy3f?)Xh`{ Wɥ#peHf쳓Wz%>r% ?Y8̬ms+ eKч]E~#Lc2jO_̙idZ(s'ւd'ݰ@=Q*@}i37q,pրzjuQ&Uv#ܟJ0BV*ݦ NU6`b;yqLpA ([]8A7UX?( <:N=jyEmNRGKHW( Wt2bz.[W ޽e$n لey?ϔaY-cw8%\Q|50x)qS#ҁ'4?'Щ>5é_ShNy7ktW4I4͍$@fļLh OQr (N\??Nicmzzi/?1B7@!)߿:2!4b= BX5I)., ;i(t wnĿ鐧?bVqSeK ~q7FDddt Q!av.?nϛĤ,[!TF˺_+tlAmCݙkl{-'-Jirt68bGLbҖ_+6N)+#`GzpEV]O/7-wǫ ybWD"?^:yb$|m#iPhղahN#qţdۍooI` lvH ;CC MG ,_6WQك޽&-2X%[~]]N56W'\H\-RrGc_e`GkŰbn4MYx!` b|LL=5jr2,ݘ!d]/xغ5AXH3g/!2\(mkǤ,Ew4f"]*AO -;Ї9v.AYZgȂ͞ﾎHalЯt Aþ[l5>KhkK5!S aq\r^Ch{Vl~JV76xg3I4peJ}˹zS1f9DnY`p7>-R>l *$!'Z8#I\q6 :{ 2Qt#Ux#Iptʄp]hMtD8Cʭ±@5H{=4* qӦ& jmvY3TfxȽVG'ԹDtyۛY{8cX*@#_Z ߻8(Ђce _‚=_: X<H:ܐ1wc)CP4LD2cREʀ1ywr%D/nu"L;~Iʖ=,$sƕ93׈K]*2>j;fIϪMF>""W+zZx)慟Jsz %Ʒr(ɶ+GH%:\\ֲ?xc/)/v ѷI|yR]=d+M]݉e_ j>En} 7PjFጭ{ͳx:M,+w^[#͔V5~Z澽\&]).,%8,w!x!ŗws_䫓~HNü%ޔ]Oq3WDS-xkhR::`5('tr{oճyƀZ78e+7.jj:51+j$#D,:^5:0(6a+R_9"#;ϛ,JHq׮( 9$cL!l>:JxCӕLʹV\OeIL"`Jy_mb*!n\ T ZVb;*}O oo%RG)n;$+TԐE^[M~zIdz^+9DzMXy`b6L ɔv{9G#pz'uYGf?8DչRz-:Z`ao%GX>Nm-O1y)rc/;JՌ*`4癝53xCU;r "#8.Kz:-sDF51Ez=b_bUvM[a4(꾾ّ72P`~ґLN'f>zk–D6qO@R6/^eYTUN` ۷Xl, |>Au0s7n}?dFO3 ƗoJgUiWӧ 2E`WwQtZɺI% 2FUa7-6osU33$ b55[$JhAD-]pP W[G =0 Y4h^;ƫ f7(r' N>Z zr0 ՙkS^~LQJVӫ5SJR'S@[E [8>7p/õ39/ >I/4҅X\Hr L(WyhHoPU}Ar@=_簂gs ҴA}ҳI[ft6à\')w?ϐPԜ^=1x)FC 4k"b\?W&,U_?0#AVB_UyinmƒqBtFHh oWcdmRLڕS;@5#x Ik`IFhn|$vb*("OfHO#r&k/ͱش|( *-(aWGQTb':DW-a߿57]u 0y+ m7ӫN<-F<{7#"(K3>{hRIҮ8VH TM1@ʤwASAi=7J(i4 iGih&jђJqz`l+s[-@UiF$CG FͩL \3‚S"3<vg4'8DPb5* qtƒ\˓c2uPy^ڹIԿ Gef^ ZEKFERò);PpKW%S4hx4c:~qP81WP缱/W͘`]κ %oy7i`'r8 _ҩڼIeՅJ<K^uˊ7Uk]kqѱ,)297ὟbhE>:荤'fRYG,s-oVg{v]D:gx|gFV\`_ōUbT]Gf`vs5%GEOCdDU h8F|p*Z>nUa  yi%"ױ~,rYYF:̹u%sp1+GN .7%=#I\ͣDeD92-=9\ph1D$0)\ سAeKckJ$Lbq@=HJm{?R<}ho/ F5=gMHa0Li裨 ҟ-M&g4l8NW^ZF|MbQO5Oo^mK m5wfZY>2MXWLܳ@F٠љkofaHUD*~(53kvA^W^'0 Wokr䈖"yk_9U 7k[JFfcdlٝ}ے,:?:pDa5"ϩ`V%)cIf#}v)Pt0e64)|{iј:M FbQM՛} y_􍔬&A-*2UG04JQ>+D9N`a ԓa[˻72ha?8 \>42Pw׹qIY<IZ>J8D֟;c`&Z/#d=Uȡy1H̡RwDtXpX='g%3/ %2tyW6BolE|m]oJ>GhDs^BƮ>jlϴƾ{g5|,Ctz[sK;I@~ RN AEλ ^#7ÁJ4hǰ{T9B,W ?wM' ~x<ڼoPEa*;DXro2_bjd=I0s edrkF~-l44wp w۟Z=R$Ty\/ }%Kao7/BSׁ*]5Z2㷡7 cuow@RXI FL)t~‡YfY1`CF\Qan85j+0N P|2FBNu337ABJmKdp4?m f,U:n ?,0uiNxa A-X9K~ZyrL#՝z0 b\`Li7>ͥItꁘY=t_;dtCDCfmBpG,?1#Фe0P{0&hF̴OMz+$AD0-[V@6 ("JBQ=|՗ M(Vr(D;}kJY|W)bE2r'N5T1 LbeY>90g A`}L zAjz1lhS:8 >"/߹z/oX2h*xC6qӡʉ̋D9+5NO"0Svt `*aN|lk`0,5ODs iZ\]E 4eB< \j'>7A*j6GG3l`={])P5gNSmԟct_0O3KO|+\%'M{ u$E#3e4HkO?A3k![AUe G徚,S<-\a +ص%wws :gy(Uyjܳt2d8|^d F;qW8>F7~RVEVD w8#d-|o򥤐>Nsܠ4@`f≄L V }d; ɯQR-Kؼe<)w܌b4LtrITWnyjCx?qKu?tY'ӒwOLbp)]ڔ=OQM†@?h Q:"d Ga-d~f7=H`&6i{E;,KDδw@ѺP }đ@|4i0v/ !Igi=L%󱩈tG$׌ R3nvߐʣ{Z E$e,B`mxeW^"QH 4"vP~A¾WlBMܭqƘ@no"##7^ϞPhz=n|M(j'*x}n7f=%( sf?AC(*=J/x{'킖y&pjy}G왢8:B7 .WM.Q?;x"mP@z\jkwQ37cpp>Ri\i0u+56laK3&}-w^7f%lET^3uCB(r% tQ=!*:/ߧ8s7C}y,Cȫ40E\P ؂&[ Ϲ,MPHAQ/!lOD S݅{>3ޏ)Y-ƀyqEzOo͔&@1A4%fߖK#F:L|~x_?P w>眣FZz% Ns7|ù{yHhQe=^SJTyϕ%~f܌}K։ ˧pLKfDj?ٟ]YK w7%[7% S~Dl T9- 3xQw~ i.IphW OUO<gk(~o3B4*al3#Y` +>WO=)-k+F#ežZv%r٬\^+v {cdm0ҡ+  9j=_"g e\:9ΰ *}+sk7ѻ]j1y8F~cWd\H6W}Jܹy]DŽ~>$t.-b}~_#q!ށj҆Nᷨyj KdkH8wRv *mHZBTM[F#t>0EN (|sa#F7tcA#n,U`@~KqtTav+?55aakoR=[F>r`%s}x`,o*RB5V͒A 72A~u*— m,^"S0䛍TN_oiB?oT3cv"MQE/tQbtM.ȕњ>4OH1{;M]ah,yzIAfZ}wQa!9D7NC4ծm!d{Z(p0TPLPPuWP(tOVQw / .M֖G"bvCpy$~?E5~dA {ae8P 2o|YITQ`+ Gx&h^n(wp!4EX$KmM3kd_$i]j5 LeW]êNk Vr[1QQ rVl &Y0nȂ=_y_:<‹xz*].QH H?M"rѬD(NPz'>( <d''EXDaS~)M<掐vQbW#v˅|E#rTLupL}H 6SҔu]!ףj1S^<#oѱ֮ZN8mh׷:$׻fPIw؇h)٣^[Udl9ϒ:kՆ0Ecu%cS {[b_EB h=B`< JL?w/`R`(,{1ۖ&S3eeѼ8u')I#KXh3Ze~BG#bJEg7b *Ł5@ JK9qU ˙SCLI¢\vA(~K?YRՐoOGhX)(^$r+>(F&1-(9 r=-#PMB.箌P"jE!ީܾ rMƅ&+,) |>'N|]狍.ގ1JrO/egʲ?Z2"`#|U+vveջNk#I c#cLʎvfUQ!Qp>񑰤*PTAy D)Wo]D[$r48Z ó@̴'Qׁ;rq(4maa'U& bw͵'gӗ`X h6^&;}_;׈Љ%"lMM[5}JQ謵;i'V~4DK #nNuI~0 7 e0V}ClòFT.J+3}֑I,˼I'\0!Άt# }O-˘p6`5/Q*kHXt7zHpp'bjpQj䛻^_}Cv\ l OSKJ̼š/|I'M$dlğލ5#׈‚҉OLPE3&hdojl,aJb:k>cs7-|n#^ӤzoŁ^lb9a kYFL;+'LNA9;d>[Xiͤj0.v=$L>RlVcj{faM&rQ8c%/ɖ+dMfv;>56fc;]WrR@7VmU POa3~r]OjK],3Ilaw}'n2H~l|B@zje| LpGԦq! cdaO261nG*,K a6&5!ɗZy{+qR)_v/,jKDsqvEhnzLhXAO#5)2?ĊkwbUJE,Iz8H Rny!Ju|5Ж'?bRluS]FFZGh~`A!“7P1&Clވ $Σ v;ֹM9|mfȳvm2RQwëwѪ@@G\JGOcIjZZmCɱH 2;z>)?\Q?:ߎL2= \reF!kXGK&E8wI<ccnW{j1c(!TС9DG~? I-QMktD+9Rm&`VIgp3ZrK8J5lsoKy=>!Z׻K1) ` Lkٱ,'p2 4zZ8 IJ"+=dbЬHM8RM2#XOx4^N¯4hqK2? - @#v`(ewiilDeʚ}vp= 53kнyu G.rܓ$]%Y^@`׶`X "1AQ@m~?RM;Yf4\}&&-M+/M- _hWMO@ 0_0QIZvu؃Wo>֕p){hEp)Y$${?qB)E ͹W_t`lka\m !-r"bPz3P- 0M;^߉Bt#u<%,9~.?Txһ/aqEe~K8;FSDm3E-ݦ ŭ^-`(C7md&fIjwo'&nVqq L6 Z28=߭?gTƇnT6Vt nȓ9K  su) g*TDAշ9_lj hP:"ɓ1L4 pD39Y*۫g1Q}a>CkMdpmPauZ A Q/Ȗc2 @0رyCƯLٍ4hj&H0L 5drj8Cj+ vP` B ö4W5eeZfpSSӊ[xR.>0GfzEZdچ `63 ֒f !HX~-ok!OC-7k$p=n?1޿j82sXIJ8"~@/JMzOHd;=m/. 0wAzW}6PK]A2(ET0w$f JT3`hqS5nP3Ɲݬ3߽ʥ,(tWq(S+P8 |xdz=G5=dd0 ?SX4Ez3zzd؇($ail7MudpFDךE޷:jSaXZ ~3giT Tq'0b`Bv4Ȟ>/Jv֮l8t|eG lxB#* R5Mz7d<[NpR'؅\ۮ5YHG;G Ax X)7du'֦tI:AZc&}SβrR&oiGo%9a$ R( J ޫEֆr ϰ!v'h:JW=zzN!2=w uU |bЗOuA谵eHd(˴2 M=[ 鯍􃕿-|{bvx`6+e%5[!_6i珞KR<^H\VU Ho#`zޔ#\TO1hG ~@TQ%0Vbc?T%~T4Ew܈Ǧy柺Ԋ7U0Jɵ-% ѣ Z9z옟; ٧3=*bӛtU?[\?z/7jtWHvk0QU2VB=YzU{\>[ZMqX!\rlo9ILU9؎kiٝ\(ʋKy :>LtwT Ŭ4ey"i|/aO?{ NK;Q~QJIjm &,-?ugHm"u.O#Toi[NEN:7:/avI-,pLgQB}BUY8˫7ECҒo7hX܁ֲ`+0z@P60;8Wiѣ]&168k!ÏOl(p'ɣ%NjV7?Hː lNEyVa"v()F}[FL(B/́di~4N@ژ` 5:af]f2qUUȜ3.xJRgh^@Pºxm`I!Ok[ZQfQg2 V<]&7VG "DW8sZ;[,U`4`#-R?1`6D~-=9dV--5R]jdG*nq4}H tUg7 x]s*;9ls kLf&t+xϦNc܍M*qNan HHt \>m ݉)#H8XhQ, 42'ڟtq\2_l*Tф7{gBх3S >1Қ_7ybAYr ˫uuh<`w?mNHӒ;9 }5[glmtaeAř}tBOֈm[,p& ^ Kv V|=ԑX<[afo{~!-[ g]VuцAtR!"cxK=39Cɤ_E,0uNdĔWDY9upb'J5@#?r Ko#qU6զ#X~Gb&H:.l˄ YpQ`F۵,3UD==bj8?ߓg*n5!-8Ղ80[e3Z^u3/xɣ!@`Ha)n}ω6K[ětOOқxJoAK8dҊGãDb-ulAs3.7'HǛ5k:밼9Y1l5X6*?wYM(1t S۷,_>2scF:;z(7v%GLVGѕ ?Zu\|;ؘn~qa#;ܯgpt'*"u):L\9ݵخr{tfgbtof;GJqy棍Qm8zJCDۧ 9/*3,S]|Jg+P`t()8MBQo:C z~C ԹpV0s]uT1ϑ[_ (ED .ѓ=E\sW\ټ(h~ ;4 (2pĀY?07kLunxE7R'vSڕOh&VHZq@`f@hꆗV/B/^ʇt 2rLڇ'7lXGp,.,j]/^I|{1Rj힥Mm$N9.;y&U/pXzr˽0x|aj xr+qWy)Kؿa" ~ξg=4ma*.GvMu ŒR˖ZK{cr 5U}}F_ jFNL'j*R?je]VKRW,R>.CaR?- +_d`wF4a*&fHѵ ՃMDH(\lFrq [-V=LClbU|{cx<͈?SG?efy~cԝ@Z؋ riI}K 8h:dNs%;wB @(U\RO4.Bew2 @AsFvG4E62m*r&} i~ݐL*E]wu= eZ? b'IVAץ효6()!pӄShwIi1EfuZf b[95|G E[{qȆe"wiQ ukwy۴{WT@V@-[uc gbL2HA999q \)Qkt03>}0J6HDh̫QRYD>"D7+T7<^zǬ2ʂ\Zy{X -!MY")GG$׋ښ8^6-,%G%njE!DEm/ݯAٙ ҴwO53WbDv}L*khNx{bPOGΘ ub3¾~rJUS 1\,/wd7ڍ^Eu5i2)AV8Fכ"bKwH2L-(0uW\YƂ Ԁ;B`DjRϓ*[D 5Uo׾ Ď $;x, "`rӏ|,w HZd^c$[kְmC!j $bo }]#'L';\AKتZhGzbNMH^'7wnIkxa;$> ŀ/} IK3Y^]1br´!U<3YJQA$tF&XrG\/Ժy@NF~ ݶ;T<$s/(=f?Fo837[}Q2\NoE".unSjXVMJb4"kldaU@ycbݫr&-~B( @EۋMkIj.);4[<1_ʚBUK( Sȍ]~|Y} I ^U g $05+ux7y4/ P(2sPdXىN1HxV4ɔ̇$tB)8a` 6RK`K8Fcs jtT}hi%o`^CN^kvmEjbƩ!Zlkj*#HщEԤ)n(\}(ԠԡCೳưi* H.na$γgc"6Xr{XԦ34!TJ0Rдeؼt}Ļ(?Y V.AC1}0Y 1,%~^)w XwsTza aAȶҜv&_9SMw#j쯨n,imX 3T> 8qWHPD%=e|t/L߯d'{iT$Nšw98s5BܡX{V#TQ.t#TY(cJDY:4_ M(L4^]ۏyk;N/,۰+,K1\'b o!)Bl d; &-wB{lS9leԫ;4(DUf||\C|Ecl<,lUmG2hKw2t"4Ӣ%EK<.v.g%]~- Jt5#NbQ,߃ǨM?D6D,~x\H2 R"*c9[E+/Od`;ˣ>jV[ժY 0 I]<s Vh4S:[!~ /A\J>$Wɐ~q9n[9 [+%/FO)E2PiT7 . ev*fڋ9a(ivpG zߺ]F8E҆15;Fő__? ]8S D>x<&hsOKwN=NG7eG$ g2QT{1-z(h6A);0m~}qo) ,76c(>WW>y@O!"1j4u7sgo<ہsiEi|IH rؚ`I.uneAH}[phJ,}% i5"1 lFRiWQ8¸jzf@>g[}N@8t)dSsad0WwKnji2SH$LE`Gt kd@J qsb$C\X}OvELy[\`>™H!=&jn2c #:$d]t}mCvt/]}Atz2el43~ZP04۳  Wf~>5T|llfwK]>˃SOD]t얀>бzWz9\#_朔tH"@5;!+ݜE˿̗Px:"냩dX5KżeD[>bL^[,/8q낹! rsC^Ѡ9K>az :b,~`fE5ř$| \׉+.W:L:ɢqJ͘CӲ}IXΓh kj?=d $;MJkG:SJ{;W2 >-ywAOd#v\# .=7}q[|-տoGs~CXiJww@r-]4Qk ugLaɔ- I]W0 q#\")R*.06Yff, sR 3>*|i.'_A,cZbGz`TRĩH@6lIאڜXIMϰmTV{i+) 'E`峈&yG'<(9t]ˠ\p>8i,U xl9|̱r~\g=ᕦ!?z.YM@YYq(V+QkGƾz5`/K k+6VZ`+AI2x̲DMiSHG;/F/Ő60񓝶 sImBY"6vT˔CcgR򫋪p2OuX)S x[5zOߞin>}*nNJݨHlzR#O-,qNo="Q#I\"Sކf @eG'Av6j2{~+iգxB$|Ϙr,B"g6Fuzڰ'>Y/Si``tvA$U{KԒ#mkwWT l\*nuRٸ܍drG#?,ڢun`S%ս ZQD{[/ /r0:D:hCMTʣ3~\}_\tieNw_PƤP}ZHX)ƌ^n]@'&S!Hs"ns8s^r~0~:aCǛ鵗J9k]Csfe*s_>Z£M=/rx IvfOF9~r5U KחsZe?/ 55\BHs5U GsM}n[ q+ Z[^ũc#&Pq㠴 {."f~USjmŧ7ÿsU }T01 cl߶|5m7PyJE;&42I_86 4WMop%2w] ccr GyBt}5;?eޗOۓ쁅},2Vjg*Y@oOammSGj0d{:ʲ<*9 e] @5fx[)_ۆI3"H\ތ㑵+ܔ!&]q{r 2&YڜHL x$V69w#R'Qep!_}+ֳ]uk[o*+ qXHHw0 ߽AJ021|Sa#|Tw!;>h>a~{;bo\>w?g/X rg *n%A]OĠJ f4͓䚳} 21|2(+QJ9o+ 1{.^iaGnݨPP:Z|- /Sc?˝mHk̀ HFPJc]?JhGrQ;]cJ )?w?#t)Z_=zE/6ÝrΪuX2P&8PB[^oҰ]9ߊl`H!Zvۢj9EYoa;V@:=F-+.Vx*`1(m4GkQJc XM3i} bAj?W"~,WQozK?{͆P[oS1!,S#/}P"o,] >d!=yipКJDHK{h{`Ng@"am&A86*mhS(m%V*ߒؼstMԱ*Q#dŏ P"TW|o v8{R)hG,|{Y&ӣ? B|{$l>I æ@,(?:h=1{F毅dugv(^4nZ#7n%)C E|61A.t a\^JҒ1$ţd|:#Gx\n_^øwp yXNMׁ\/2+p->B{sIs1S㹒'QKPLvI|vg 8 f$NY>YEHOT37) E-+HӼJ6tʳ,@zDjI\).@;P" !{q\x= sR9 F-JQ\ }5c?!ROs˘S)A <9IQj 5ΎJwċc c 果G;!w}@~jZ'4_ip( N<Ⅵ-1_JU#Cx 'b/@(KhEUwv3ik9ycyiC^#PY[p$߭3f&$΋ y D9pPrio^”ң'+@+}rjY3\).CBS d\<m|H&s<-Ii?)i5E; pijDѶBb~ni6Qay]#'FRv"d( *3~0%.P <ٕ)q 0ʎB0͎M^P FF2y)d{tpsԔFs*Fed$qn `Ms 0۶Ԗ-d ̩HkGx'2 \ R"&]đ0nO"na s[^OU>Â.c8Bڡ#. 5/!5*;PfǔS]^-KѬh'We= #8S'0u& <<1ɂ*WNt&Nꕦko(OYJnCmHF駎rB(pYfC9!2I69j@:P: m3V|;wn!"d‚0i|4Zve@FSusXP-$FV!yn8;!J<$i2xǁ!K2(xGDĈ!T R\2A7ɵk/>R/X]cw[_*9t24ev|u[9>]4B-xFߔgd `2g&m )'"cc'y48]%7*w;avYzNJ1Fh|(15JSJR*k'ڴ=R5r&ڳV;&iz*#d0B_)CDs[5n6~\D$#NH8R4E@GGf;kl;Cd?b]&$%k N-@_Tci!6 sn ,>eVS]V dNrm%u!R)fź|V:d렔]]m[:S@?9- v}>39]?޼Q/lr ƾ2Jj`{ i,W[Ձu'.eٵYQ3`YYDz4ضyl:[pOxפ̱.'͜EKiY=9>|7Y 88T+Fڙρ/Cyu6_*^lMibă8g(DW& â [dP.`"{%‡Hʫ_!x)!-'o0*Qvo2yGnsW=S28$>4 -i,.9|LFq!XQCF:/nAF6{Mм2 &!,Fp>[#h}A'piEvMk Sw|H^cLW礳/N~JxD )MWnp֋G\16-X)G^2 o)$"|_^,WD@֝;<-Ud+NbVb!iظsE1<֦%6dQEoUk'/ lqk[]KtX}/^(TVpa+4XO AL{'bp7F'~YY0z;k`Įk6E:S;_7ڥXh+j|b,YEֻb~ECEo h W-PV wYqYčԵxlE{K}agB ۣ* -5+ol~iJ*f)e{8ϻ@XLKQ_-kj5ig-}"K5]A Q.gX242,[c3:)?/CxSP i$o_#jAžtP> R+H}hNcq; *$dst&@<223[Xﶽh`. TSd5p<-$J.z_,N~ % a۹tYÍ *ݫ_% }!8EW#ʩqr5OiliYe$$$#})C@sx;6R"Rs(OܞKˠoA|B$f?KBZ 1KOŷfѧsu9x r߂bP33du3J)c+m%m'I3YZ%Zo,qтP bݟڅhƿy]߀\HҨ7GFQ}Æݼ7pF.!1x]_IU+q%Y_w>7͂]aOG$S-sFI4gu_j 7^oO)RjcE_7sE<77#.ll C\ULJ*ܒc'-tH#ߩF"rځs92V$yL&NA%OèynA^,ʣ_6Z؝`[,&Szr@/ !rW Aqe9_ )hqwӗ-hDw%oPR #H.ȋGB^St,"Ȥ =xZ_mQ++6x{޾+syxG/I`*w/5ʩi'i.L/ A62 anP(,Z7YBQ0ښ_e5%"jk504^-xٍ>'\lU7KJL-JGܵ[#dN_[AJyYKr%*qHd[;6D@Cr?~$NY S-/Myi~^(T6:eiFM* ,G"&՘\ NrZ}R%kkRIhɼj.jD{vvl$+@p}6 5F"?@7P/7s5v϶VrbXN lfU%Ej2ő%*a[Sdb_mRD}):4`ɶn'U$KFR9&.fʩN~HxӔhAsvbb1 F{"\鲻0M`C JaBo)A7DpPJ! C=mKo]<j/w ?:y"bTn3-]X[jƗNxqbe4-Оe'}tL,w sceb_Qܵh+kW8*B[ʂ5Z9$>ǫ[4Hfk+mE y$Cd<6xE4β.o_x4bV0v&Z>>r}K",J%ޘfd5r:bed^hLs3$|z$燐>Lj_݊e[wD%iޗldVpwhR&E[jzV{U;ɍ :2Jۺ6) Jgvxt1׆yWbGg;5% [W4>(Vrd?E:R'R/Oh2D$~I$BӽJGW[F)sw,ߣ=<5smQtZ'aiw5 ^Ojͭ@; Zj3(_bH~Y2aY7l"]Xs+mynRCpGP oUć{긃ܚi1x[2|i pxe6X4v-(?8ِ`vbH[S.=@\h6y[]#ć?;pDUIrhx1 ь5b2ڻh?gRQDXTaxgj^*CC_ac 5'Ȑ*Ԯ`LLơ?'ȟxK88Idhl4aR=rA,;9TlT=Ϳ8#e$aB???*uĀ0ofIQ˾aC2ht)drlY9fщ&ڤ#bc9Zd8yMjy]p\FUx.jlfnE*1塋ps;G*EzVSy>۫?_/Fʴ;A# &BV00$g=jNh ff(CB.;G4U]?3 roai*`bh]s](> mI>AE[ 16BԜ33{Zl8>3FOU6nc_^n@X ]#cjW7dv#ulF 4U5E!qob*&Ɂ%6l!{NK1T0{Q't]]q pKġ$- 6Hs50^#Uq #s`2C8(#?[EOyEո̕gE@^[I:1hG*텋VLk8û5`G$n+I}XG!dWo=r.Ķ8E#GvOB,='%7KTs䢽a63}84mhax^ޡ;|J)-pG`U}؜4i؀z rNs'?k5gtaDIgA>_X7_yRcA`r 2f\_QxTG>g--n-j+Jʱm5|`^yIEvȕ%S\$60PјI[T԰Lr$3Tt`6eEhwh[)yːH$@ Kzf ?N;μ1|gUt#]cZ야`!˗! (BT+ą2\+*0Z'NTz(mi˞zv؉qDcd\Qtx`ʌ́mM2;B=acBJS:[ibwYe$gtZUn?6貵ͥ{ό>i*'tyWpgrFfBxڇaؕ, [wqZ ym@>m~ZeMCɽO*\D@'ו|v&-vRo# "=ZQjٖ3Y4eϸ?l{g+xuYu. 2je$a0*Nhխe0%fiɓ{ Oh'7$_Fai`Dnn\󎪕fD0Yݥ2uė(KA1,mD{Gv<@<+%SU=KY)MKvi[1K.I1 8iTu~j<-4,4Q+fsSE93R& jT:Q劌qN1ߠls}*z<ϚH|Bz25.q`i+ᡍ%cs&3j_ ճ>sJ 7<ԏ*vZv6)Sګ#2eeye^W'39ZE!A$ J_hYQ%_AWr$,E]vZ9AN%)QݍGBlhQ2yPTO٤/(e*[r K"_5"vMv73*~0:FpLP) XƵU(XX5Zgti%gu^Bsqޯvn\n%w _#c 1n?{Nb*Gmvig%3Fh%5b+%x<핅? Yw-;3mK%Fqۀ^ o/P?G+:J'$g^ >p<-%*Guj jAZ'?}/ jN mӥTot2lCzve5,! a'r0zpUh(aƴ8ǸۛmT)c\yV&j}M6:N,1EG JD)CU]v}4Uäi8 ɫ%_'72uT6 P)c4*0t%6dF08udYsG pn8Z G\Ey@yb`mY|,k0mt.F5s R:ӹzC̺(1fˮb0l~a,8o/cr4!Z |9I4(QvVGm|Oj;"sf{,F NzbbF(GxXGT]YԲL"TR:fM5!UzT9J) ( Z1UĦ c&Iłs!S\b(`*\vc6qB!a@.^~>T4i؏J^ J24%g[Q1HǦbAڏyj 4EXIH0x0f>!ݍbLeƨ[XicßU*(:9J(L%╞[~!"ŏlc!/ww>\[UT3JdgS0W#E)i11!Yz;~Bvq ̽g\]XdiٍT܎h㶆aHt"X1$"m'vyo}pĉt+-N@Ղa،p Y:07H:r3/#\.6sS\!SړS8QUw%)[&_#1Ax8/z^K'Oqp*.K{L_kiƄ8RN!U--NzB*ŝ~J6$\Ȭ=2}k p?/2͐{jxQ)&Hr?K֥2`(SO\Ux ̆Yg- B orej=7 Js`FMdXP֭d 3i̤sHuNIh_4 ?%!}H[2b$[RJ^EzS]R`Er"6}hnCMU7vv>[(oýoGl/%Nz+Ȑ =%zt`~ֲpUŹP7a U<1Pl.J+}c+Q}ZC`׽ (~%jÎ"$+v89*Eט]K,W@l3͹ň8"$X蟆ծ @^;L{65‡3=ɨ0Fqi;;Fjiw6]2i7w f1]#>]}~]u-n?}iAz^ŗ:4%Y+)r%c> yQߗv)Y$]egUtpsI}nG~W2!MKG)š`TCO>EIqJ? 3gDBUkZX$]x"hh^$"B }pΊP4޻4N@63d#,cUo6 0mxݷzY0pv25YDzVڍ#vNڳ6R:ƭ"*[nB*dZw‹@ }<"&wG܋H̸})6oB؂SX%I"I ^jwء?}?zϹU!FHwyKdq{\AtVAk_Y#`|4+=d@܂Fo7.,U8D7 ޱj3; z%@@Ѧ 6:k7iz~/NZJAʹ(TC.1 3m]۸b!`"<:/9D1{1f'\`ޝ pW v ϬXGGLpF9rQ='Mx}7ky f%zb_Bwrd0[/"VQ3[rzƛY!?|_Ѝb^L %C%\?`>s~^K-#^)~7E~ՠex'īSJ*t<>g.3Oo; (eessiu릜[4`2!89B&D.|i{$ k/@QXxP,WPB4k`"TFara_P~*BcTbi2)Il+2HI(DIl.G$.WerIbI>}QW\|µXfYV 'YQ-7t]jvR;M,‹QQ` '=/?$Or"+;<\3ި>,KTYxC#.?#SL4KTd:v-B!Dw]|L&"B \Yrбvv&^<#n7k^qLʲ5b,=#Uu/ N/ªouu !.%=Tfo= GM%#ubpJ=QE&d9D!,L%9p̼ b7us4LoCSC7(͂mG$uE5Pvz)Bip3 M,J.+y]\弧G  ~¥vNx@㫊3a]Rnj*J`q^g߹:Rs6.}H!2;&^OlUR`.7B2^b**9"0痟gMyX1"5J)2Š` M\2<RdcRh{&KI)_]kVYa ^d֩2PIT!ky2K7ϱ.9*@s?=;K?¶l˼vk;=̀y/cx}lb+mi[_.x!ώeW_`>qޒn$S^zY_-9^FSSEГcGdv,{M PStc+&^G You׶+ߤW3"2tdYv6*`byFjgete LCAÚ{F$ B:rpT@E60b{;r"[c s?Z ɱGڥ~$Ĉ(dK桓n7>-$]Mu ʲ# *IuQ=8$D+c (hDML4}':4|rglFw}q9]u߈ޖgFB J1oz:TqlTb|x=JS*NoJle-87K23LtMN4o-[bS!|mOHu3h6Ejn($$Cfߟ 9iM>\vKe]@ӑ1r9?CTpq*rvQIJ9'0 *,!U1wz}h[m.}eSnUpC99@?ۋZn6F J,Q桵à<݈٘Gex]{[>Y<3'1P~Z`dF,(ۛN58JP5}XB!w -UqJjS[Os0,/zVZߌ ɓ$T/,=ӮQ⥄SR|Fߝ¯&ϤƳNOǫ: z#6'+y,Ty>Z db:/d~/G+gJl/2،9&\@wV)e+`!SQ[;--AV=K&wn[Hܕ\jD4 `{Bo C,Te{FF= Gtv3e|dhjp'uz[URr^&+7;u%IN9n+GX#?^ x7C~%lG6@]B{$)8Y|Jތ88x#z&î9 cZ'b/=Q߮@86H[20[ Ý-y]MYGĪo;P <4^(u\f\o=Ir.&U ":^Ҽ_+)c 90[>5BVMS`U 5de^[Wl[ Ns X/k3|iB 'r)UON_K:)`,Ao @Cл+!)=ͲE%yo{:oA@,m֧܏jmv\&FJLCC%-[#1X<^=ӻ4gjס%{ۦǂKp[kj~l0y- $ nҡGݠ|cOa!a{ci*rGhsgӆ&6BS$u6@2zjyS`bᗠojN>K&HRkP[w[3~C2,=u_Uq?0JA~;Zm dz%f{=GjH 'ڎ}fO> g|wh ]ES8mKY*ªA5H×D(jeȯT)쏁:ל,VD?{v6 M2SV'@aA[H" +250GƏF?'W߲Y/cG͔hFC=f׊tTG?ܙw*Ǫ@?Ȝa(:!)c} a!DTY0㩿H]v_p=T=u,wk}c%j(~M^fEI$:"|,ueU&32yک6uFؾ#tj6" i4-ųG+)䷠>Ԋ>wóPp7!v -sfN^b'\cnWΜU +Iz<}l/W/h% 2+\ {1}i7$w])4(WrΣe>~p"\#x \n# e,$}?3bYYߏf}mWi_av{D^'P8z;d3c/ƞ.瀹&E5W{`|fgb?6K/}ׇnc2C#81gX؎_Jml4}»ϖ3DG"Nfv5P/F?_yDPOW9@գRӞt J /'>I5^ruX[q)vuîse (RUa4k>W k5\&HT*5%Me2`>u`R@ MN*%㨰B+Q!^I,f [B JЙNI ƞrIfߎ-7+71qw휒ʽosԘ wD N EK d%hhD<$[6wQWy^ǒkzJ] GBsy 7g~Ն(_(kP_9{v+Փ `ۨO1Z&ɸyC񒈒!zu! )%z䶧*nvf{5: ~ C4A*r72iwf[g&ht)nۋ_ŨSxTZ?E7P_57\PP2yx,L!QDC|r7".u>cQ 4WfRmhW\ T]{JqԾvJP$\֨˄Bc ! K(mf<||d(md-+?ѡTԋy욗\͛Ό8g !|}aY-)#5<A̓A$g !CxlYF$T@^k Z-D9XQZ5aZ%CͰD5,G9BoǬ $ )\"0!91Bt͏2gAa1`ZeǘUxj&T밯N0ɥø{vBG/V˘[wq5}!SI_z÷%G%ѫbdZsOmR '7U(pbhCmgBjMH<^{y5ٗ VjhK6rh1KxD;z$,,\c'™_(x&Kj_NZEOLgYF;\Kἠ ʏX)Gd(G>ؽVGcki Q/g/Z;ãLiUI8;`E6vuGzdfnΌ\<;CGv#hbN?GN uO#qWn$~5%)< e#=zV2z2h.lV`t9DhL/[ZҠQ0x`vJH.|7 zG9֝ l|h/B xEZ?h,gۙ[fIaj͈HD=YprP/vP >:es0PÑX:ANrB(p68I1MZI?A|/pCO&լr~ /b\;V@s6a;D:krL"p4tL Ædh@ⶆ(xiiݕ<%A3ԅTwPx-ݓ< x>"IgJĀ6LZ qjLyjwȆ[V;ٰ͝EJojޤpl P%3vz3y&m%+ Q۾fr0{ NQGJs Qڹsk\l[s jL"`٤ϙr vBSP{ֿ?qZAPa ǣYyz2x`CAZ'_1w3 Y7J8煩BKia,Nt,\B1)`[ݺb{o[$HS;b%J9ϣ'^/: =rf>uEa0׿6 jI\')#ӯD辔֣HP$[kHmoߌ<պ)u53! o d+Ʒ`j\{rDH?67X™A^4q/EqSh]Y9YNS3{ h*C(@+J[r2W3װ&)ƾ]&$/ɨOڤvKqV;KĨBBL@3߽Bʣ`zU(YU@ hk Zj-/5ɶqk@P"=Duۮiۢ1i`yc8n. 0_ :v)x/few TYH$$\M\#5U0F.b=7 4]!x2fo9w=-ieYG 7BùϘ# p w]$%0S2 A!xe),s>f[)mѴv0;5**C#e& G> [NoEn+NǙ[$Հ<'}N*5t{KuBJDu`Ygnʪkd fVAQ0Te OM t )bqî't4 uR/d~,X\u= dRr?=l;I0_<M5Ȁ\ OV!:=?7|疡8{#G })({Q`<[CN[cHCY]Ӫ9Ѻ뭯8`KX%H9,s7shBzWzZ^?GJT݃*^{K,gIZنb?1]S6-hte c"#UQS:^% nǏ# E^d8Ȑ2'c~̄'$sUֵLEKoaq }?\px)uGOZPyGӗFmso"R_(J'yO/1%st#R?c8/0ncҧ.eNig+ldhvOZ.eM&Og7XgX0aL`R3M`]dQ>(E^\0>C[2伽`] $ < b-Gs\ a ^]C{U]y!_WYoJҊR֒!XM?Fy}#Z?#8hk4x{gB9>Ryiڽ35HSS;Kڳ[E$vZFKS M?(C N,8#}2 e!Oz.}hH]ѷCyqA `W ߷; ިm>iN/`Vc#YK}OvtJUE;Sjv{mH {aK`=/3.*`$J|l㬯^Ȯ{S@O50W*gW]NKT=91A:?X|}h;Ij|}-/~qBvetic*!UU'#{|`%I13jf3HȊFj@xG!S !I{i]rkE݆GXп#-G0$hA9PFdYYv s>)f_12${jG?AIF$S-U*?1"Y"64 hufCx \#sB";`~`?_%iPjHL93fm8<ՂK-82hB8V]+Y(SAPſ^I `3.)3l LhiJjo@*QJ- ޥ\wc5%$Ymƙ6ˇsFN!F3 M0oXݶr~)r߂z>b)Ta+6r'goɌc$ _+g#YrKG"#22 rMJt'|<&#Zqڭ@ רq$*)(Z.^@VuwdKe6a.'r8Fޒ{"fa4K" ݘ =KW-0qH:XkG)oxkXJ ZߘJ+DW}hG =H|gpVqBĂD1`]̖}o[02]5ge 6=| poeN;S /%Դo ϡ;'˼e̹NQ]703,.AO%km(z̙w,w/;DCbbR'ܻѷyw> y9[j_,ׄP9>R3bj orkC >< vmL@?}?ޥ1/ 'k\GScrDZV<ȉVSvp OLu2dzV2b,\{--BDn+ 4٥PL^j_7pj)H%ՎeJ*Ў急K^ FMxP7yˌŎszь֡0rxiC˃2 b ī䎎kpC?NjǪzfONAVXs(‚=wI)fJ_:}`$M&}Rd, OTQYjDX, "T5N3SxtYn V+ZEv$D7`?mZ_TԔމc:ReFc(|*x)b 6FC+Cm9 ?N@h{˞6s5Wb &Lsf3O/q-"ݽomutG|\N72ۛ+__r"t#5I,ƽ냑x@W]_sd)". 494,wrk^s)dQv=x0ϷI؞#7aPR\45ߘ^7X$_wl{ݭPh-L^_)65+. hF<%C\*Lx'sVc8Mh-`w@ïu0_ dn?%krXN؊zDNkU!i$iUrqe{S}/SGm#i zlS݈b+4 4҃^jq}e{ڋF'6"KkPR+xSgGQh\׍4.FOm]a%Jͪ#yrL"шrI4tnvRr+8+PoTҟi!KtCt(F4 ~'QV0s]1ָm8>aYbHmMe5 2~c v7ۤt4ԏQ24:*C\#`-2s}{ϳ"Zo_.L{-΍ÁLv ;)`*Snp*Z zCdr31'/ea\ڷS=x}0Q~]WuqvstuO9t<%M &hYKӠtyĔ*0Tg%Hh@"%E0M4. ufZo @zE=REA್P{꽀[\ܔtmw tPMb2YꑼҖtTcQ\Fbt65"K5M3&KnȔb},[|z ] W aN rw y- ݺt%3H+>Hʵ%(:12$&+]_9tKh;D&]|xJMzK _HSDdm|rWJV;E?n+UՐza#‡ޗ mǟjIX5j}](B ` P, _74km sz[pΧZ[[Ba[nM+$êe]7?MYwT%Fv(WJ~Z}Wv 5.tTzm!xs*̒\)_ OL2v*h;riZORxv_ T\mxdV=R"*S?Vx'9|sX],-%(Qds06![H0 +| <7W`=E/e=ZOW "Pr:T xqa:GlSZCifN8hsPa^T2T/%lBTO˄k&& ’(#N:fF D(4{)3:̃7.G\U.E3D`X~z_+4v%LEm?gY;pxWck""3YciakJ|Vl/AdE,F=ax=)2q#OU ܉RuQ:ZgG+`iL/<1 r}@SKv;i6;  ׽07/b3$QNԑZ1hnp;ݻ;z< $⼤ȍ|ڋfqtl X9AbL!`ka"ov>AOAFh4p) 4Y}\o3p^8j޶l67diwI~]?4dh/Lgc*YhYWKV"7<Կ:˜y{ٵ( [%$ڞK Cӓrbӏ .feAp3D\? 9zPUKGYg(Hȉ:dֺ2;E.gZ!s{L{EABvJ){%%BQl(PU8f#իH+ޚw -IDN߭Pp>m7TK1 a,OG-)e.G/D\0NjYݥU v4sUV\i8zulG$FJxpƆFүK cAxTc1oM>-&!G8h GűETۚ{^0FWH--/ lJmz9ƾUxCчZ\&\ɚ)I"\ԌR>6pa!K٦$O’Q ܆u[[7㴶Eq8팙(\.CZs!9E-((A1t_6ߺ&AˀM"Aw<ijMfS(h0M隽"@/5k6A7 SQ5^ZM0G;t.Bp"(-)'ds4SLaG8kAt7׵7FFʏ $SDz]~|'I:c1ѷH~>UCu980]LXk]LoxηHc gB[7<40Ɋ?Ce摘$;(f3V,3 e ϋsͫ |ea qr4p@>7\h;N^v VBCaJD6;o1g+noZr<t~OZtͼ󤂪ioSc]#\?Cm~Vy0] L}а[sFGH(gl ccju8Lg$`Sx')8EU wtM*=)"<Z3ɅL~G -qy^8 L kvv3./s8)uvgH&_7t-?@j knE(sv7pWjn:W,M8ѷ;vqnr=;+ 2ۇr?0!ZSdN0ޠg,ů|CvpZz>1 z/ Ni <ϴDyE뒕u5mO։]#ς?ĹsW@lS 9K_w+˭IT<,MYtņ9g_fLAU)SQ*TGv{t4|kX)̊&A&pWO/ekW`/橌"AeQеsIl6AND&7K5Z}dgj h[X>!&@W3ܣ\hrxa(dd"3pE uQis~S*3ζ]6<#En/.4J# \xȐ|r/dD:`WX\`F/$'],o"vө=Gaq9:+ќdZOtp|[}>KV Ĝ|ª0QfE}4;%y{znI99{BGYO@)DXXp5;_b(l4i24k{O==<7ŃDG~q(@LXTS C8L#P^W+`e'.z[|e`k\ kUm!\ 잋VX<: _ Bzq,)_^DlվQyRΎ@1MY,y3^boOlx (}R]b8uPaz~1='~+eoݧ2Xcͦq ̳wH2̈L7l31?A-@NׄyBP ˖K3!O,? }Hܨ$.qKN1G<d+'{MƸe=駱3rRfY%eJ\Mѹs!e^)-,[=\Z`hx/@&%5O$m*5 SJR#)[o)W/1j wi6J׈+0xkӺD2}8a)]nҾiJn[; L>ejHsQd 9Z'Ɖ(2#}{(HKaƇ?94OjDJsLl?]n~ԯ}bI>#]Ws Ɂ3 YJ[^%F{c (_ y fXAy!ȥ{(w9o%6$(Wo5 ÿ,ԶAƻeԒ>2 9SHŪcMʺq+~ص"_9"ͺmD#^ʺ9L͂/SFܻL}(m_O6i7|pm݈XS0R1wy{N@$IʲMx 2s# o j||σoFs~; mF>Ai|9CYUāu &[ c:]E)JMͮ-BOJ4hm+vM%b!N:(iJkڲp=+U#S-Jgm6;Uw"5+BSHv ĜpЄsceB`a1{G1I^;vqmn! D=;SŝuJ\s$_ᪧp)3,n'e*1& tlǼN`(JǯInE*sztqzN aokEyBTB^I'4bSyq4+,Pbθ&Oy>2b4LrAwwB|XLO>խ5^JBIXwb뜛x.u9@qMu\F<25y[ʼn4z}@kKUD J oz,xGVQ\@}g%, wcmgOJ_w@OY\0.P(i ({?yߜ2r`92 (&ӡ_xA]?4쏊H,dzCaVZ\sLuq}%|u`<|Nޯ.##OH/R}rꎾ TߖIDE OߊrgS?gv{} 1{ajM@xjlvԙk! ?B96IBUz:7>F@̠D2ەSAkU,,>pwnQS vDUUEnDkێR1*(ntHs2${S>jh,p~7SMy:LiYK{?MjV`BVY٧wBO* oS*)ȭ)ut}xښvk(gh&%0hHLƘ1Q\ӑ)וha/54a+Ҷ4GA`=íi *Z'lo}y /9T{[{ӶI6kp;%Q̼xRt?cI0YEP\H1 LXj qrm{|~B۸p_VJ|EF,鍵JǴWwLF4T;xYLs\EYr`/pY1A\wߢy Cs&,xW)^vsqNL@6Ļ+x;;31:Pk,{m4wť4rw/͊$O%ii?Q9y\o- `¤8ZPq{Xv سf>A#ߘ:HQל4~f(p-ax&Ei"O ?z+A;)SocXL4ޯŶT ~⨠έʺx_[MeŸA@8Yj[J٨ krJJ8)n?sl"V#ri!UÛ3~/!FXڵ/xG+ Xq5{g%5ۆ*S =| 7xu}<xZR ^R!#-UWr}*n7fY-,?{No 8XC+9 dlR\,j )F,8 Yyk+<4Tq] Y!΃~TWda`UKnH?ӟ|Pf\ *v?b!if~+v݂/Oó]5?9wG& ĵ fTy7[Jg?`-_򥆯z6,R_'I wHlU}Ef;LEpWtߍzN TDyOw2qo+ZH"?KJp7:RFKj |S_|ّXű6!/~,)~ٗ;^WR`EK恿kn9X0Ob7OO$Չ __CsHҩŸpCl|tmh|n|d7"-;׿ESo0n`]yp'˓ -_;CTxiw\YB$hZfDnJQ ~KZ[<pA1&?إ!2\@?Mnv90~`Q`9ݧ #5Fmv; c$;~/spXqn-hMp嫟W*_k;zSCo(-n$ffʠioЮGdG4{HӼLQ,'*mTKgDQ\A-q%%0wB>=?nX W#  H!%  ?2^ZFS)Wmxw97jPox4,&9'"z`=f [[|hy !x|x&X};Z v6Ph(t)su yI}䴐vBtN0u .Jsa.v%jYu<,!aTOf)?#7ak)_JmjltOlvI0auT1R |$-kxܽuS3VrIQ ԆRA\\ B$ dbz ofzI3?v2yCY'BF&9Qݨ &MpO 8t#VLéecɌ;?PM{ՄLG4=,0ɸ%?]1 rKD;QD͉v[rE2˧d?FSk/MnV=uxPu Io"j4馻42(Tc`_3Pԍ;oQJib2!&wp^ƤC}~Qc0s`?Y{^ԃ8k[r8w$~IRrO0IIO$䶠._Mhc0q1Đ?laBdaLGh-s2`{%%Je;edV&mW|h8I1iB'K cݮٞ-#L/]| RwvC8]86_z^<%v﨎(dx$pޛqUfttc9#r8?ԙu/U5zNltXG＠#}r l/B)1MԮ%=<( qy@`wa\ Je;;[z٥5i{+p[mW̘ednD !ĶTiaLр uO{ @tX~e5†C3ntu0E{V.}#WfO$=LARGxG>ypNTJr0(x2unn9!`j0ffÑjJ7z:l /yEasH1a/3N=-Px(gsv0f(,#%zh_Iq#&]OGgzGvg!sʲUcLBVo /hj|WyXKڶA#ގh:a ^i),}c{zo HsOvZMR~(ti'Wȃyf!ê:y!4Ys(ڭ^ջWQL^IzFc5au Ӡ9:oV$XWƽ'^t ۈR^!]zCGD>Qږ洵) ih{mRQ@A 6`l҉t$:Z[IH3>DTWWU!$/&ećNݐ85#AMY n+'xA^dj8IԌLZ[)(h !}e[ST97s (=Q nN]LZ6#=(=ꤌgʑ#e)@‘ 9 z!#)i\ѴW$Y=jܝ6?Uksc3FCK˸$b$8Q<)W *}zO3H WW7DZxϢyN(|- uuF_Mu S=[,nm.ə΢Kd:R:,g{ob&2V~ޠ u zrb:!ҴݲCar= t1/6PH)3ٌN[{u"*! P׼~6&sZ،])3 |>HGj~>٨52o1dp|nlâ8uKѦ_CF8KsaNHj`~=]B}0QˮP0h %)V,)R_uXGЧ߾y1a\ec\ *~|yGøGOj C(3+?4_I$PD4yfS)#X ={s&ny]d\྘Bgz fsId4XAϊwrt!{h3WY+zJ o!6@x+2oqg[a+ yY.qwP ȏV·E_@R {7_5U-0 :|9?Nuj%wҾ4 F"Umg΁kFLHhi)Dսv!HV bmCjQ\H](JJq *GP7TLV PN /[g TY/ҬY_]%gd]Dʺ1"y%KǨҦ(5aYQzHWYD*Ґ@9).OȸW`5Lџ#^k7k~!,NW]ehbPM%V)+zp MKS5!T;dt`WQoq*SӓcTU6;ޝX=߇ip)~?B P. 3T1a'(;N4{ay48oy ~BT5ns".JLM,I\k0gŁP5Xӱ)/mqݓcV\Wz:ؾZtXV: {ňy"1;HPp+%,(MGu :!voAR13\V9׺F=Vab@_5['ڭ[u6w/n~[# %mA Yd;[\'"!qVM=∤jKh+,qB)4'/p"HgcQwgk_q){Ù>VQ4F!9s/ߪ}'{P]3~5COu̢(b+We# ^V25lHˬd㛎a0{ Ktצ6.P@cTWεAe8̥_`dqd+P>(5}X@ 5nZ읔zQ\9Y^ms Fjw g idŸ+i0[+U?-[sQ+y[d]Ͽ ( MɈnEi'^ե"y߈RCK8OJ0#FtU!"qBm2-RMnЮabb|XXlt+/qv( `mY )M=.uׯܠьҍFpCt CiܱZ܆T\*?[r̜uхQp߰J( +m?, 4_!ҁkۥ%~ՏK:S[J͵Ǩ#)-vEO:U;xv('Mә:h"/tJeS!SLَrUbٲLq`MsZWV@xVУl.%̏ …'l_5ٗ~xӁ>=Osh˨?f݋x$~3|n_DT2|,$,>jB&]d") k a|R?~ _' ]ơ<9Q|_uE3` 4JuwHVkk-^^jy4EGjH2S]|0{b=od#T.0I6c%]f6PGôՃ2%] tXgɰGح`*[C5@bC_4X0 B0qg#jӋcd7?b$0riZ1ZؓAF2u$(9lU )LE}G/#/x%ӳ؋m:< ~J_f 08.}~%nB8w[ φ~2v$.'p鍴mROpZΓTJK#̨v /:~HQ 5uk,n:Wu2E`'G<7fRݓg.應zoFQ$6-n_vlkF$[^BhR9;h]ң jlBB",WJR˦х˘A8ռkٓ!Ch΢l^j@#/J<0_/3**u]4q92*`1t&%SvvQne2# .u6}H1sDٟ͓0)Elo'`> Ql%kamNIIN}mkBJ}-PN,zmZ1It#q8wԛ#(H0.AEbV} }%S€vM.r]P\$\'𽜞xgOǪلڴ#`  0R\4j˂A,TL:Mh?lG?F/b;KY"v8 [,+oO^'e|xŶ=un`t)uHԷM><*MfSqz10ĺҶG5ZQ/SVkRZN7Q4J^Y>5~HQF^D00ȸw cJ>CN0pO^fm ]f-[冯y X, N;js65kHUt˨rqgPq<HIZӗL\N4.:[N3psbۢH潜=JkVMWҋGo'֞Yr]AܲI]^EhOj W9kk|_Bq t("#ĸt u!I \ex)+]֚~rǐA\> @ZoPʠm~sRGG9ܱDFa(o" FI_Ϊ婺e7cR"gq }&,v*B4K'_=LqLe7X7AO{/úEiBETr@(r;1/?PlP0LS9#* M<^Q8wX_V^K^l5_앰Eq2W^uQn K /Ig(ne:N5e:ljp"$Q#las0 jjN׈'$.6pϘ5C\XZ|zvcO4̐#ۗ Hu?RăH;'݁0X;;*oM,kG+zp7 Lr"q=>8R4gö&\TC}RQﭏ#0rm UN^xp]{(iK k5Wf*zFɤ-5zL GV{G|h[?x=yuvQl5 ? |ʈJ c34yU˴s0Y @uY[|_dϹ*I]3X[ S G{!m#A?51TТngl4ALy c|etD_#{WDŽ~Gp !$N_ xTh I#D@57q(_şB7v"q"7`?')i#%2kܧJ睗% ]b? #{O䐰FD|Ւۉu qp=$̭=“J-^;\P)6j8;}Ӿ{YMjitIy0ewݰ.3Z0Q9הp"mc8UF]._:4R|a([[Ѐ{֘ D\Zt1ڻpL a'7gb3=sξ6.,r@4F_xtWGo {b ~)o OqaTL4K30o|& _EȜ2'5lZS9UGxd" '#)1_bg7 ԚS;=;ҎO9¢ᥳǺc4*Aה @k8,])A`_<Ãt%aRWā_R{mƦf̑#5[znT*I{&RN%<2q}D.*"NwKD wR| 1U8zj>}(V,yzENC C7$F7 = 9[ $ z`179/SrX܍3ޘ&q~VQ8sfD|`"HzQLUg?,@_j[W=p'c8FLǫ謼ۀFY*EoU=%OAγ|Xv:27Zo29p$<9=rjlf"p.`|7a4*'b:O_,Y]Q? W ~f)i;| 9&\J8Ԁ]ƽ[uR_a*q Jh) p$H_ߨ l)XIG*҉JV1~OX"-YW!5Px\ζ2דPalkb80㒆wUjX 9`O(r[JBކ؍*Hbs\Qy>[c RaB {G%MJȳsd3!_qO(mTa$XES PnH}}xP | m#~mZ^/|<&!<&1^Yw%[l%J3qaHWbr&9i<"}:FWf6r1], [z=0ӏOۋb;"|g ^a!ۅҙ-mAv$m#Ө6v;)A M7vh.'s!QPVW8TJ_CAܷթ -죏su@JՒӓ詩j#n$u,:@PԘlUwz@fu04ͺ+%X[en|ް`|ʆ z?CDyisxHB,2 >6nsu:? K:$ K-l5'h[횻%ݛ,"xЬh& (m*y0 &^FqVCKv:|_IK <+4yfsϑ'f;ՖA'0:E4e1 m0D*wycMW)뺇:j/'z /YSמ /E&~E<;Z_2?ȶka0ꥀlwTfNt*ei?ן9ezͤzg/ QfݤvOI6.(x<[BQR/ lh@)-^Fodץ Γ6<К֫W}N8Gj/_- \Ję87w3#=R,놿#B` ;㸣(RŚc`*̈́T<*K|C #z%DˈmG1ࠛ<층dUl%Q4eCĂsMʓro# oLdjp]pmh7xQK91 CYr%}=\s wvAT=]'u^\C}NDd z4 1!)GE죭$I(I $kwp:1%U;R׼I () mt='LJ}>W4g|!j1&;~@a4c*Ұg F\>_{?^sQRzM[d _zBq̩1i!kJ/5ItaS]}8OʶcLfz .),aH%zLFãZyԚvL5b?P|)&^Ʌe$kb6ܫMdP}}ެ^pٲKf{eV<+-\JI>b # ؾ ~k@&6K5+D4+M UާƻɖxMpn%veM  hZ^9'l>~{o|OI-~f8c9:q&j)%,=ג Es ^CgXpڪ_j'XtIclGwp"t ><~fu.HAg6RtM|>Dv-TP6́| 睤no7 BiHI`{Kk;e:܇BLĭl&n ӻl YX4nPr=XD? ƺ(bQϋV[ԿP݅i0Ƶ ?X}oUlR[fy/ţi|PS7/?ˑZ  ޑ2Pdbmd:Jnd< {Ubn NG*| !24>uO1W@[@]*Aup,?͵ɡf+vfvWMUu"R1¸`Qo~zqҷ S7F =$ z}Ń^55G0N"K׽^$Pǻn$x[qA?ŀU+wj;U(YIb&3CcIR4ة! T]V ]ZHq'Zt`a)̈$h-Dx<EӰ7VTTn]ڼpw8@ C88VMt7,f[ His~RI Vz^FM#̋;ڱ1lh9rc ~'לlqo[u\ UZR 8]z_~TF`L&9cnTt]&9:sueA%&&TPk_xȎGdҠb0+60, y{p%=PZ8 ސN ˜r+3F5RAw`@q }˲-uD7|yN >O1Ѷm; hYJi Z*0+>/PE=ܠ&!U 56̍`M366U0/@ű v'`䶎*|: ۴ -3e!KpZh)ސk;Xk5XOe|nR2' O geKW *EnZ(1o,L4/lP>8) ,˪2,au oX#aJm0d]{!߉e?L_G8L"yyV"xvk] 3T#P'[ ٍxN:΂>*c p͑SJ1M.q 5?&AfYQnggRs{:Ιb^h[T knz1bz80#;$pչj3! ]8yNÝQL3k gGoysO:ɨw*K83wqUJ/y $'-D7% d x;$2>j]ha1d+_K&%/3kpnNS+$̮ ]g]13|*0Γ;('4oG XoHB(/Np=,2\H_q}.Il9#bCɲy*j~cPi➣ MY,PD%ao((̿pJ2 {WTynJJdff뽙|R`|i-=fzƌ4L'WF%;cGBz!>JvMF"@ ^D=dz~ 4)wg V.yF2]6ʔxdy;IT.Ҭ9 &8-6&XwH)W֖G ÙD@0}z? `s]ZRR<} xp|<;6{3M tߔޭr?,nGvgx$FmK3It%&}3Y^$ rz"R}%2fNO_ ~x,݊mt3E%Tĺ0R$QJɈ>&+7XMH2\tDŽc+4$YaP=ZeU ѴKiAϸ&M;.\]ww+d"J(ɀG/s[e09/>L!GTS&\D!0Yױi &';syrfmWkmzM'ъu4tcQ?hS6VC&us"F4ƎI㸋aփXJeGR+V~i#9_hx4>QUؓW6B.'-?Bd9rZʿH>|wgtS6;qqo @fw81 d=ݮ"72"Kg69XĮd@r%|𾳩{+)W֍8;x__,[ bO 4t^VxOg6yivϿk?W:1Ow_{V?94j+zG j*<|YnU'̟M{ oXɯߵ q^P.Eǚ~NopB_aIIǃܻh 7iWx*,r'p4#`|tQR˱dT>g: \sՁ,8|L1:kY |ץܓ'ʓA C`L չ(rE@ L*Gbé_ 7p Airi^iPǥy|g :comuFcn'%UA#^zMeo dbC8w?ŝh47B\ $Xzq2 \?0K`ɟl7viuϗ!?!id"X=ޤS7Ȯ=B8׷2{Dr*O*(AK01cq0 ϧwH>]X/F %gx`Ou٥8~CD x]BF$w}3zNJzxdɀ|m=9=Ҡ30Za/E&5nYycG֘۷zlύZZ,Ҁ޶("\>RCX#0,}?5$10B=0wA&8X_>@ni8H( >pJx7}]Ts:Ҧ/ Oׁup1yT$a\&AY tSw*PMУ\B`M)Ha Qݞ7&%`ɥ9@Sx2n'3fb{a/)6P Iufw};67 ~R!=K:nn4#;Q}6|Q*;كegAF0xaac~S +^7gWJe7u_D6nNAa$DU؃V_a5oxP k#rX Y I<{>Pe8Ʈ4i,'!2.фxIӔ%e9E9%l,H{4i[qfQf[VF4ϭDb \v6p]ya `ޫ*F=j)@Hѯ+HhV{Z8<ng Ye_ QHA:Pk/[ÌC,o]/6♮JGaK^ "TbS%LimAiQH`\"/&12r{]'n\|.r .,Fo">®qԦIY 0R c*nQufR'i .;qzF~O+zYe.zm.HU r() {:m)5SsW\|pIC -+}9zd.70QK%^" 2 ьaj6Ēy)^+O+"5ۛJʚ"XU9i|U|zE[`IW6c>!bEtyL1]?4.6z@j? 8hI<wq"AeWg+B*+u619^&nh驶jZ,v2g ;rK~0O[YJ2 D7|J 0zA(o/iTP?`um(LN.:i._青VЀ 0j^خ&3>ȔO@86PKnd͌ iub̢An\侮,B<z52._N1D8Cm]7c#&X=`&b*xo=֚^y O~v^nAGĻٜc'T4]Mˆ~IӴފ26ک5ơx/@ XN#oNJqՃT{bp pU1u%&nmkk.q@}"4FZ.P꟮h4Ws4V65% οUrmqet1։2 `\Di>h;4U#k:>}WTT߷ ŕ)O'(}7GV3mnYDF2axcWB E8yn mms{ؒ+qB.3U #&חn_Ϭz T] {Wy%^5BN(p;j( *O'"r> 0vq;~U9V:S4Ȝ[ͪ0*dTA'Y*nw|'6uoIt#ߋHǰAj͕sv8flO]Xl7D;A6qf!^k} _: ] s'25ZfbiQCryqvӟ} ^jT'OemC[܌wnMǁ- [Ǻ+`c=7' k҆gbAw `[{ׅғ\OKrdP5vs {om ]*h-3Ly][2yn~=T {FKO <`Wi ԃH^"M ",d&Z "~m?yvv:q7@ST@<" .ո;cBm[5+ç57Nm#G:M'2F!F'/.!ە|FFdS]_KԗU G{ECϔPO xJoocdM;dBD kIWek]~3SW2x6asDtNQ|*[X'uka̸PœGo G_EηP$I=eD8kJw79]!47x_!] ,is'%#B bx$>^:^wVs@ǝ;~ڄS͓h$<ȼgcy{ %~ zw^lv]!qP߬1A}Q5`| NY\㕥kT,(QF s8E4+nrj|myB@V +\#KK<9<ޏ@%'6698C~DNEp]^u?i.o2e#ss -,|vZ§V-h4@ëS g$;LQLz5#w@&[7=={ж 2zɅ ‚# ]0fùrl1`upmFpTjsf&f~Bgl^{2;)$͊Nz:މA#S~%OD=Q$ 8'|Z BR~է_L*#2;Ptb}!+B\G/6Q0y'g󟝨U/!@M>vrJf6{6f+!њVA?BsїUR̼ثge%O_"ݻ,_5 .GhyVkt65naIWasmK˪v1 S$mH?:jfm|tK;9(t D^^cMjLhI`(+ uhʊWHs50I،$,R0ynE"׳o/MsJjw? g@z+H١*}wzH1+^\k?.db@w^D$DpD̃TO,6~3>nDmvpBWY5HQk[=skzZ*p4*lx9;ȝ<2cEVs ߜ L_ϲ嫦EKy@ESƼbL\fd zo T˪Β8RKyޗo(0o+b~Kn z p]*_h,k}KhTW]vMI<%͔}Y#Y+-CǚRP /%O-Ojw_Gحݮ!Eh17sNiUT&<yTAv2XR3:j>.;t폮ld|+/CUԯHvDn,O,dxȸ1oyEgnNjsK*_y3#24jUk޾KJ|B+ݲ@&8u5zUK<kDxxATl (pM5<`+q3OLQeg`l,€>saʖYEic>, U/;QVD/vB{)¦L%GyJ41/T{oj߽F4pA@˓x턀CL{vTܢč8ա\ YlV?ZCs̪2Mxڥc7Tpgtux({lvDZ q8vJDVPʻXtv,1~ LvcAzjuɩ~oLϩuys_[AH9B pYu)B۰_$|"ԓ\21΢e"#g^t{␁ xDU0Sy!Δ3ͽ43Z; kݸ3ITa@)|]D>bkFVRd3Ƌ:ZN}w&6ilo',U @jyK5&3 LTnS |POy ,XM͔(mt$ ? bܫM+Lbucs/^lk38f_(7Wv>1KFzmU8կ)e /`S?};?g%2&ct)t7{H)~ؾĀ֤SQ' f3^^;f|zësou+ g7HYA"qA\8"Z.{} >YoMRf]7 w1)J hW賦ғ&7Cs`7x!PoZqh%9 вԣү%KMU O}D3 i}Rئ3}"QsLCҫ&ba4Um=u+,HkpLQŎcNFj]RD;b~&P0z͑`FM^~CLLKf`뉥v:IhQzp7)XȀOW33Gon2HL{wu[5;n1:qL?#z%Lc\_V/WVGQiU29usk/a%}!VZR"L65J_?x* & lR#r;lIv2?Q3YOͷ4QdB*SE G-%=a`y B?wYvB6 9]U>G+@#;d ^kK2Қ'Hp G]mdMdMKYZ݊PD6 g x3V@Vbg%@^s{ l&g歷z}yJTë3f`rTL )qfAkq]% Iaŷم,, K6<"fTp*:=拌̐_Z}e߸yA2ӶzPA#u_Kzf GuߣhVxjgxoa[d޴-g3p2(yűzm8A#8(RZ0/uǐ'5ɸ@I9^v?%&7<&5ϲXLEPF>T%j'VxJ ӌT-z>ij]E+G)e gx`OGb\{ؐkV?@os$bĴNQ. 'U*C _?a!*w';]Z%92XLE|_I CcPv+}(ϚzZ4ݦ}!߯`vqN䤺Hv/Tۃ n466JLr"P\xO 86H08s:˖bpWDԲ@/p#5 /Se2+[oG-mdvLD*LF'AgŽ ƒ_ A_ TOLzИvq"^T_f%)1.p ')6دP\_ZXpn%ʋG>MhgZy`+L]#/u)<,-(.%'6r۾,IN#6 QŰ31-1Dz9Ti2Aft8>GSr˱|F?l2J)T Jysm>>h ]*[S293"A;^R$xZ%wyQ+r,5;KNjJfSPt翄\;p,4qUa\ghpQ18BC-X]ھ#o(d^4vU«nWKp&kYoPޯy5s#KPRUd73 ~Cظg}Ρ-Wz!π ғB~Z'NaԴ뚵pܺ( eqm˥{'^!d;!5Zg=\oi _~}hH̔A+"wOk~d*<H-qUt3Qhˀ =pfFR$ ӱ\F)F+?*&dK ݿ 7D%*5BoJFg},2+?JE@odgd2΢:C8gf%2ʟӵJfjy,cNqKY)Z04ʓ(xvҴ0Xd B\&ji`ۦi^3T1z!MEM>@uW4VuJ!$nSR;&6ۄbPFu|2!h7B70^Լ{5"i82BgԎ_/?!mڃ;n 4a3 x 4,OfVdzȚ:[?qX߂ԉ<onldgśaLtPz 0rWNﲭ8C22Hp]E9 bճ{1}Jv14:lU~B9~qs\L墳'hU`|{c*I\_:$Ò=(R݂ N&.RyБo ԬDzc:O0@C7vrCen& \H ek&q#:G3$*oN[c# }U~PjU6&X=gףoeVJdq>xX;NPc;†.Cqu2K6bYIJ[+]|Rt)0[O qZH_s>n9S<]\mRmp󶖴IG_/^YIzcplOM,Ui7M!,ın<܅%Ldd }5Yo{`mW~D !.=hW|Oȇ)CڂvK0y*_ -:Gao,lУA/ l$|v ȯ1ų=weA>WW$;j`X%d8"^Q1F1lPސˍ]^ dFӹi{ceq4Vk2xr4O4eB::9bϧcÈ(T3WFjZ/@*;XWUuꑽQ<啕I 1Ǒ%|jswZhm2${,cU6K j;mFm/9=RK,`Oj`{ټ;Gf}V:VfU]n Q`Ϩ$p=kU(&XǐF4>6Lj?"Ǿٮ]LJ0ʷ0tCީ?ateX v\G30s!݌/ VހiKk6m6Ӷ' I >-9P8+^Ε8u?شBġsڳ#|s3 wؾG|"J< "lN=v K@C.-X Tl {麾S> cc,=s0NY޵g]jh2/TuX?Lt^.6 IM AOasQ',vaskt~ =yPn:kZ/C g%:C"@cH.R]"j)AZ1؃>D-.Piv-{%ey9E!ܱ'31W"*P={8o[nRtWUWa%S-S542ȡUU#Q|ڒ!d+mI~ }jR¤G<4c1Eq.rxs=Ñ9N#׍p>)bCl-E-3bm4ѳj^E j?ּ{js3 IQyH+1ZVC8NIԌi~T%p}EXMJXtUw3̯&3iRL*g?|#}Yv("xej)ȲKJD( r7<0"Ttޒ wգ3 [_ xoch$TMb2^ ItZEF/WD.sQ1'-g/)/$*>(۾yj&"i ꔭb 6WЮ_dE*KO|p[0jSuba&Q8PiX ITS w?(;2;JX{MDHN[ AjI%Uctg Q2:h30$[)aÐڬ@3fbYFxaKTJ<85[?enQ!mq=3Nn_LJgTTlgal#co ,x1EÌv3G7RYQ/8_ `2:LЀ "M|3T9.[3LRۜXCkN6iܪo 5dZlE@,HVpq 9-.hEaMnд'NqOeDi)҂snk B(@i.@z`띧ʯ]{9!ʰgHp#P}YTk&=XA{y9E#SnO<(;!\& v'&$R |; $tFh"]A\Ioi!6]iq=lmɾSRVi\ōL ^ ]-Qv_bIw9L}Ƌ^(oGwW PlNSVt9k叜=f\YqitmSǣTQ79<M|;]r䷃;JU'fe4M^b]l 1#SxX 6Zpl_jPY~5Pں9ҜS8(!l"NϮ]4B Dˌ rjPd m1= H5BeHs c\ ^V2݄D-Ǻ.36$Y2BU2Hm£rȸDCⳍm^JF%iEJ8e^]U/5a.ÇaʵڧxI}I}Vg_@LotݠMmG+g )5#ȱn}b! byzo&^B ]x2-~V,3-is`;>Ru]IcL)ڃ*bTr>e~TI: O]9P|3#ǩs˯Na. yGT7묈%VsCNMPl+2qMf<{ tPW^m5R9^j&\ښ&XJ$ӏY9xkccωPÐlް`z7/؂Isc.O__4݊kiLQVKc'k:k2R $7rs񢉔JsomL,b+-]g΢|Tr$>8f(I42;~VmfCVСb 3 Ap;[@J@~B.Eq;)L~MeCk:&J5OFĭCnw"n-t"d[r|?!%jX3G:/eQSykVMQ\V|2GY w@/J b-ZY(,${rqEm#ܭ(\)&@C&ھ 0ўdob$=wQܤ.K b:HZ 䞫,7xZV`6yLρ' iZZģ1I ɷ aA7&@XeK~$:Pm/3Q$Aˋ!}th*; nң嗠 $>  jWLوX7ޝqy6&wLۨw'n %RXVyǷژqB*dÎŁPv@ϼh}©<\n( |kcXN=kCJ#O@I|e;UM야jO;lfa[܊&}Hށ W8~ SeOtauIY[52s8>-: j^-nc跑~,2 At'=-|ކAHBPGZ>$ xچ"JH8y06(\zG77eSdAyص#D9Y:;; ʘ'{+%(t۷̕ M`eXib&.u)Z1SEIC+=Y!P$R%S)'.u{_:h׆q@K6?OQC'{* Λֱv*E NbY7/b>@G7 ͦ^>SAs7xz*̸! . *$p1D+)5$Cml_=s~qs>,. @AOiB\꼢gshd͗u>'%ՌBw#4.0m#_={49ݜM*eq sI}j&W9ocTJwKGݐcɣ2y!aAkclvZߩ05&ƹ`߰b9[`ؗ!//c%s9>U)K߅|7_2w *W8X8N[= khإ >s!88M$vbω'u@7cc뿦7 e ~t0CΖ[SPٚJ b' %BB5k qQLǒLo%ˆNǡB[=c)KJz8I梎l} AOPwy}wF%?[xIKP2yf*0I&j s\e}/u/瓔ަo6ȱ".e mIŸ <11SH$vحd?*2CDvjV%&^w)R){'?Oa|9l6Rg<#/jՙ2: 0`𿊂xx1.<Ӡ`U-/co@5LH܁ 6H+SHj7Ш?Yi(jdZɺ5={z3MRVyKa:W2,8O %2T5Hvw@ Ge;"EhEP&XMmϳRJQ2fv҃p+2@yp1 =IQҎy3ژ )pő=fVu =O.ƳAyOuX~%ꛩhQ:Ql>aq V1MA.%"Mm(^<",G8y M l/e(Ĵ'Q-{>~OѨ6Ze:@umV*bEmZ2z7|Xm{"'lC 1z A>i.nxۇo1 E'J,Yshd^B]yzI wM|oOl Ww@]8S )[d2l.Q4q?|6\ JGL9622ɪӨl8‘tޮ>)r,juju5waQewL&΄Z4]_ĉ]pb%>Q?FIJ-dQ] CkPbR睯Dn>"FR - 61OmQ9M,(ϘJ$}x9vLoY2M%mn="ѱ v2N ț.%rH_npV,"by)& ߜqT+R~`M+-"HVq83V{1~{eCIxS^rdpՄ i@3maTЉ8&5ԨV< Sn1 x C@X$1|#[?~Ԇ+߀(1Ye ?mRMF-''b`|xkkNlW5pZYt0^2bx}*6N@-`$u7҄)&+8fK })گ87,M!q^5LX4 NHוBZXC3hn\A$bzOhb[k:\6Lp唩{؜HY#-ϛdM."c}Yȱ3R!6^ehLD}<"7:cf\tu˥y-R W>K2ng\S9ˠHI~Vq bxDoRaoh;=54-Q˛b5HKngIR3?^ߖ0yeeUin%S(P# uD%Ê+1x: eUW%K|IPU"oFID2c6Ngfy>6mHm?='R IsXkn?DIj}?Cp(:W 7mqv"6 2U.r o[՜ $H;yP7AF\n}E;u4+!xٟ 7o>~~W3v:ˤ77~njF+&[7m }kJCx:`oBUL牡L!EF]Jt*tLi-?mcHxXFm+rq j%|렂P=QkwEs3 8I@,!N*IQf Euܢ'/ˢU(? %R ̆K&_"@|GrTxBpߋ}?i0 sA[oJ[q"ue3od"^ QjWDN.,;诏ǎQC鈀;,?6̧g"\3'Syg J:FtɍG0:]M"8hjſ/h/l ybؕb>biPل |3,#\Jb5*Ƕ,p25D a@?5dx-~H r}ȞF.4vnQOw(?Ln FW͓D1!?EOh?*;/P6J a4t1&wXRW'M/Z-ț`?l)c<)0V:s]'"$M 'E ŜͲdn[T|l,ٺ{ lvi (;}KhM}<(P]t~]K3S/kmk2'xE "*txvJ@Jb6N/2 'udBtbW۬=.ca#7c6GH\eKbBi g)BgQq9 w 2#M#.D%lP*لE}<6BNcKfinwO> ^Ծd8( =yثRHuyq*PA^V`XOp1z(%$~{lYH5 z]΀qJU] N'nx@T' j; c%haHqۊ #<6ifSr18S'go63F}З#ĺ(r6Q8Y+Yؙ`DG{z{eH ./ Kʑs= fޜa[MZ!?bb0]RWgяisgq~ Ri /,|ֶ;̥\Bdh\Vk1ѓ1q7쁙7^Byl6Nڄ-ĚuVA vI[j{a2n&PUFRN{+#ãd޶.SEt?vVyC\NG3[tȝqj( F4B:x4S27vR>8:9|NyF`NpMwsPAz՘>™' t[?4d-X*jAa '=T;Q$ecQӻ+m"c%k>nS2`qS3.jpڈ\U)+ EJrIrFwe9pRJIpxß)'bXI܆'`<\sGˑ:p%#797D FN3=*F5iP\A3ZUP#RgVbGٵ<+H0qX@D] mVrπ]⤳&<w| f^P]06݂~<:sڀ[]JLyqƇpW HY=t@. _ը ])rCEa#K@)eDVR霆@ʡ[. :I:ܸV"MԜy zpb9a'=OS_m\aNI1DkVQeSCͷz5pM]y-f^eDaI`> ^["7v%^2KBe$4s^}tgnTu͞n/^wV<NIk_ϷO}])M,O0uo&9wӔGߺng_ aq?l9]4VHѻe+qr5S8Ps+Bg Knyc0f cRڤ5i7í Mx}%FJx[U"'>ᒞA$rma{(2D?,?܏sABJU4 ʊ۬j.F"_+HN'Ztـ7&s` C.HY?g/-~@hlدz{l XS .*_!z8W.`=/SXаjP| q>5?P-1^F[0~%6T`qi1Yf)r[⨋ObY8!ȯeӆgSP[_3\tEb%9O9*!3jҢFXE4MGxsŔ;^¾D{U8~++$L`pKYy@ÌT~k8O&ؑ̕eǞawԭ`MzJ5,ShȆN9vg[F~3ўKp~z/-4)y-=L|G_˩dL߮?.$CzŐ UXy5ZESC1 Q8-u*@kXHQȊOO A.9*Vl.[f оPI JSs/ (osS~F{&eӸkIk ɺNƀ x Rqu0": U=W6E=ǟ| pkiSE wQ3T I8e]{y D U>[F)\ A՚*QR_Zȷ+[t+]{<9>n8ۄ޺ -*88n2 LNODs߈5cC9PPmo% u{ZmK>DA)_4iRrX^1o\SKa !-¼Y Z8!teb@+9H,Y œ-šgCp{0@DյXq]%mԲ\T`6RAl#^U!aS W6B (8#m_#pGg " . ѾcgP ܲ#2 A?RNܚI%h0>VEln0;a[Ad\@3ov%&|p{Qkqs~[cۚ$;s@<qJ}?X~H |QěZ`n(j‚MlxoCb.\#}7t66x2r@P s<(^j wܛo. $RO+` T~I ؃SS4>F>3oIbY2x,-7='2S9doz[*Ihc}ƍrQc]dR9ŹٞL<;b3_:V{W,tzOD[4˚k-T{ ҍG]_W_; J G:.RtN Z9_޵y h6!ؚp\d$Aœo'S !bَ:)!aZG h@\m=ڽJbf* S߭Pp4ZgG[ZhSQ3?'d &=tLjHZds Wga!+ qG TQ?cwRꘔa'UvyؼPټ7k<'"F\p? ~& y" pyj[/`-%uqRhNy2\KfM p`KxxuF74?'UP9 H&ʒ0b6l ySavc&k"{z)TzrozƓH9"h(Pu.eէ\ufg^Lǩz ɀ 75p lJN %R+eXa3i7ڪaA ?͓\Bď{3TfflnSd,L.vu9ʌx%QA&PDA02ᙛSZ{({S֯[M0]3*DQi dd?*ck,Il gI$duU"+m +:JQYP}1[oe(݀kuN Cy!.Jgɹ`7YG醊kuTrlf!Ɯd`D։_'C^biWH!eF]qmXoHv TF*X!ZUNi 3{9 9!EAv K7q=M)y%Lyܸ|G LWd'!W9:7c(`̭և?w\2  :?x=ߢ_e_>o% [APsEѳ0I!8Ry~}0I*3!,XԴ{ܓK0.Y)AVtcS7^(\v,OLs׷dZL.fTQ-#|ՐC jiTgWٍ:%Ex VE el:,| dQwzi{}=^^PGvD`3_(d쟦(}6ۖA8z[@hgyߣO*0qӧkGҪhG[]):-]D{iuXcw\+&,mmx7L2;[Z'Nyɢ#*r f\lUVٹTk#7-HI`i5q9s3V-jiNߝe0I"U۠ʄΘk\za+1҂ɋ8zM߹% 0 +Ny*u!eh%iSۙd6Ȥx_NX#27x͌ |\TsxZv\~i-XSXM^n)ߜG)]cΛpfl#έ=6jI ӂxC6|j0:WUN"\~XZ1!3ƪThph},QB :sU%FajT;V4LΤ*M=._4"rU#>~A2IK@V~f8bin|뭥`{UNPqCZ#sȭ,6Un] P/p'˔9k|N+{37UD44!)-ƉĮ/?kձ)~p!Cv8G9Q6,4Di_(ù|HJRXWKW[| .OlAzKEG6k{Jqh" ٝoz^!E$%%|mG2aIi`MoqZ,o HH oc ?ԑk$a1yՈ*vj=5 V!-pƽT]tXMZN=;Vi&F2rw|qs*~k>!$Gy^[9޻ecFɽSOƐ*wgu8R{Ć;9F4^5@ZPU- EtX@?5vL&KNq%1 3 펰TwڥIC|NeG?ڧä#&*&N鹀=<yɐ=^2GbxS3*g/6hfez.g$K2oj,M7;y^.axQu!5sX :Z5iR_+c9`lQ$-W|+pkwT`:#KL*F&>L4OvaDϸGΈB t2TZ8WM?<}97 bn>0:MXEImz85vNFN]²SË>Fj9{JgC/М~@,&Z]c 9z-зijn.'Qv'nv~n&w"*Ip>1KtZ{Ws,aDom<+0ہn2R1Anx MLoTF "t&*[J, ,_~&WU[}JۣK< X/E AQ!ȶ(8 m5}\ҳD4RO DkMMEz ø75a ܩ^ O^ ̓Nq.nom/4St3}7(.t`K.D}(DZiP>Xիebj['/Xi nR{qfrU&dJ=F<ݪ~,_S Wڡ6,ks=i, ),D}뛴3 6IFCڼAZit$H| $&91 p(xl"Evs d7-; %dR6EPY.Gp=;]ZHLx>ar^ `R8-5C0rC u%bƑrQc0\" ; 4+Aʝ]ZZGxֿ/#tTi~l!j]X\lCϧ^ ~ >mr1%xX8Ef]kޣj "k.zz ]o$s-!zM+>mK]MFp{R1M2 b8@d,( MŵriWW ru1]!PeuF]^ut@'nMab>Ə~wv[`wn=Gޚ 4k@Y^ɇk:8^zuR> 媅LPI1`NqW/` B+w9\Q~T}E3q# Wb 4[}k @0v78::8V%jAtbȬ$RcΣLOKRUBx9I+_Yg G CXw*y/@wg aYZo=C;~尖!LB*zц (@٦ 0̏S.#i&&d3Yz_.:{-DԚ.|jw@\G׮-2i_+¨h^OR U<i=m_Alr]n8$+]ZE6&B1'A\zy*{ 2O/&i0H(l'.? >46/5^zef~mp$KQOú`)))Q̒hGu$] ya84;r[hN^e2g 78G,j$w(lܵxݿCz/M!HP΁'gtUOfިo{;xBJ=kWAL)wi7[pҹa?wr>>œYW/9Xn/mG ,^ʗlyRnBbcqb9<9&9oLg8W,LMԣ7:'pcJ iGk93Dw4)ʽ%!B3ptN@-0{x`h: u*ֱ˸F`. fd)q-0{(ܧ6aAإ]d˦'0$ȟ]i!\y},% Ӊ\h}Bjd'sR#׫B汽N1w('m<?4a_ItB:CzAwI]woveY.Yww2\Yzq9HXV=S L?KҮXj)5/YIG?M& *uB3t Cg7t!6ziE$R$@;$fM1ALyf4 $%(&%XRan_yX4ri %W@L( Z2v*~ Tb5ZK"ӳbCьnIgO/9nMNHZkOV^$N6Mb=1]fG^F!  S8:ljUzਲ਼UF Q!5?kK]ƁXC(!/lcjb[0R̢!lܷ,Ư0s #_p̞KZlϟxrIh˯{ 4n Qe;{G%ҧo/xo%aоiMA<pn,E BK8REGlNQC\CZt1M+97UriZ-|T}7Qޗt 1SC0!Hwg8u{rLuJώ@j!7͝!f`0M WCc L6"?L"GDg;0I#25Ӕ%7 2AHj`IH 37v*sba@$6RO8:s:Gc\*27F;lvp?Ʊ6*%q0GBw-h$mؖ}M"l+T"i˥6qy55j.? P=|Q!M"ĴMz]^LͲhS'Kr姬ׂ[eWM@at] e"UXMa36|fxzpKXv?U5>d_| YjEhڲ;W 8.ň1Z5\Lq Plx><2Q[p-1m>pDLLA[srW7 9UvH,%wO.P" eiT#cpcI?d^ߣ)l:8ҎðQϰ"=72 Lʑ-=jIzڢޔ"Grz;WOA1_l; K8ՒPYʍs*9SkӀ.gZRCr!iY VrN*斓.8.YVFu7B%}UC]&d'uv{^Z"U^%PA2@|rKf Ij]r Iv=8+,ŷ|̲Π{ {^k{،L6giAbm^C;]V/gSZߒ"Σ;v@Y;D>vɝ6:Gjv3->? = 6#?GF5t[GYv[j'[~-WuUQ}`KCW[,2߸֐3&=nE:_Nk_X+Ǫ"JřI..oΠݫYT|凕bަNCqi$fٟP pOE&QYlF@W۲ 8潚5M[o}4t=ю8a6𩸗=qK1x,A\L8=?bBl *ZEY5peͱ}i}tss_߿G/B -Hx񸌋' .\~KGuf֢q1=d4--{&s嶕 dt@uv)tYy͚sEע ]1ܼm@ﶚ8=Xm$b 7>/M{U=/4)C<%IŁyUJö1.21]*2Qa c{0}h"C/_ KP\w@G0 XDF vUkyM yȿT07DB0nDW~ >J Zt-X*sramM-t!wYn'&a8GNݤ7uƚ<&#zqe[ps:#M:dΒJ  ~DUo~"iŝT}/ cĜ&'h}b2o`3WZ_b3v݀X:/;iL_]OF,"0E-AaDLG|mQWs&|&.S@!a|@!Yۛ >=^nCâ +ՍeN0 sZlYW}PsUt#5H,F}Uqn%pS=qgֱaYǻiLtQXtB2ezf; z̤YO21Z&,6@u(s"/ap8W~w3Ft3ycPs}ml-ς)7?>Y},N`]ӅbƫMwO |RM@%^nǘ\HtJT²DĄCG;*ΖXS\h"sil&y(JxȺT3J925 I0mGYUݘ۰!d21xҵ¢iA-۬3SvF>gh:['cg-а41M7xwa744POt.QB|6֥>h2Sɖ Էw:8l 5^&6@ԓert hSIYa/=CS ]wjGsq]eO+mhtZB"XǺ4Nå "yLďv2n R.;j%tRk06*:b.h?U|:p{fW SXRBDsdb>JC{=F*@ڡ|) pK1LbKYȌ߾ZRK ?0yO_B8ٕSarc̝*6,%1p ~kEݚrAW,96@|ԋYkݐ1(A:Yk@3`a =>;lǹ2Jr GZIt,޾H}I$j|b)@dN6j*pD }g)]pn!>HۍZ~G;~d;S)}ArU7J=DG5@6Ҟ~+=|^ ?~_ѓ'AȖX%{\V7F2f/fmmU|I?W%J|di"}{ ic"DsG!٢`L5Z_%nbb(c1;vZ`>yU',O7'5Cpx lPo_ݠ#~>KN)+]kbȮf9Ԕ KSZTH0K7GݕG\'G]}ްzMQjtD!QI/wԽӖ_a$ (#Kg?wq#riLu,OYR̐=#L7|3h4"sMKtMQQ 2PY[0:;No}ZuTpXBtv- pJH7L 0u7^jzI+r 4 ƆgV?#JHJ\jޞt?LڼV"6J_*1=w><_8J_uz6 qe$gQJ̬|S1N(\F2:stf*X1C0sbfSo^,v&$NÖ cDW1O|MܺWlL|t 4 iɎu l>:7T~?N[ lE[ ^m7GHIPP#ޮJ\(A md-P5ݓ^ qfzGEC ^v&r]]ݘy%~QNk0۰Fy*#oK ϱ!ܚ5_v<qwqZ{/hC>.KT=&aڋ䐕Rwp߇%A,j.~l Qi#uξ*u!V=yA ؞Z%G]OQ%$O- Rҗ;\ym4R3ѱ~cd*D?$(FE)kb ޼P(@28\(jwA3G=(ۄOaØ(P/akqLr̒lڂx`^E}By`gjkfgIO 7@_[/o~E7DL UTU7cry 6U*phc^=ŘxIjkKchf55lV*n?bImX!ɎO0yxo^:W.'5g𰝳МQP?g3na ysoń c@fiֿj -J8'b'+wq Uƥ&JIRߵd/hZ@f Q[{nv{gPZI+D$Ɏ]&ϬtAhPE0ojԦ4?acp *[.Dv J WBR8xp];ptA#R .ڻaѶ: Tɥcm1k@8iުr-`ea+#=xR_oMT ;KxUs+<";4`L´^r_FYFNr.[>ͧ7+N`]ζ$@%P?񰚘vbsPnMIzʘAg cmodDPЮO;v~-rV,jt0L6B 4M9ZH,~p5q֎ZylIw&JM>Gމ`w FƮ JènJ6/i„$kM [> ف6=a3V}Xze[@,#|:EmǨ¶E ʴno=pڻJIt.NfbG ,z&,hnxkȆ[8R4bǟ7˟bVĦ@l,5i<\>6;r H0U$ʓN>('zH!Dm0CD͍D *&KX[_@AqJ:2Kgg'Q=1"{Yl\ySYޘ;xQ*gN$2{48(+NB`rNpI}P!uDޮ\y)YuddGZ=>V H1v8 ga_B6#n;Ht%wjalPBBXAu&q4GV;@BRv1XěL;-ܝN۰*qJeLQrh>t'U(" k|pp-k ]k'a`3rvִcNчgfY]c'/x:eYn4MT#b^$"z4SFY7CeD9+c߉^*Ƣx4Oѩ7 m ,GE{ o~f4*2_{qlqsd{=էKh'Cfk+T'Zww2^ruMsDt6#@lWG bb^EeE.[ o'`&0nig!@A&.lexe?4O$P2%ϼ&٨P P̀ީA"C}?AgB,X@#As$2Jb4&o2w%6 őV2zuP7툻p6+Ă/[TG;cTAw/qd33= ُ)J/lޗKÎqtaN}xɷUm EfWd3c+:t0b[ʹ*-z^OlP]:lQIG|oCԪ# Vי* @U8=Kl;%M)qe(;@fFyH iؙ7_nP+# Wh[E"v$LE67R|@a 4ɸ~ȚfkԆIE2C#dg寠@V*lLq&!] 0K&I[wTAȮ0CÖ.R3hmPC֪tui-yBvXb5|9KGk: ʤZhQgiFviil08Ӗfw ]XnO:A9|qVxwGric&!-AK295zaJN'HqR@h} fG=+㖼WI'eTdJ2A=c䂙}`A4"[$ omy\ w㮤*\L8 ({ٰ۽BqgԀ,P;7ݓcOJd4t(:|*ŞhRv9vSpu pƆfTsjlx'M@ b@g<_/1/ T9>>%rWXMD;uJ?%AvQv1jG#@`#[w PB86W#seHJ+ۜh{ l巓o$J䴀!":)U*?R S-8ۊ%*{Dl(' H֑5wtQ/gDLbF\=VΗ~`LbXrk2^$$@k0trG7]hI~Im{n-~k܄RxQGԻD1%T*7b1eBIq`FS w Bd N=v~'XN]EK{R St>vOqQGrY+@ᐶPvuwTcՒ( OKv)b)r}x8Yʓ>b>U 8L#Ep9+vkHۡ7hUhQE1$pyQVih&  SsrYVVXl-RBaEv5nqc-;{񇯩?tIgn=^0X%\Z"p(JPqEWFբ'Xt9\wGo6$lt]c$\OYS?g=}>޵\[HdnMN>v`zPhkQC3x t]2J]gtg18U7[)ͻdyd 8dlq,Wp͔ŭ)˓ JZ7Z\аl[ # r^8VF-+ڨ DǷ>nCaMn֑ LfmWͰE7I1DNjD00DCsI[cxvO}Cp,Wd~7*b6&rRd"{W/\}O,h]uч*ۡ :3@cR=m)#*5*2j Ll"YzPcHj_GmG#lٍHJۈJ΂Bo#UzCa9SD?VT7H| F, y5Kkc_W~gĺ`֜7ߺz ՟J=-0DH~[8ʄה<\uό'^Kds?"Gw5SӯqINY` `b#c +p0w34J|RQK6dnhJ)u۴+Q}->7/: @1__;6 86G`qmt9:>Vl[#0JƐNt61 󲩍U؎':]ƹ!D|4p89@VFśٜVx#ckaŠ/pn\i 5sbR$~eφݩ>0K}=䪫A?ƻW#ݍ|9zսxIŋly0j` 9x5+ la)b@- U2X Qw%ʉ5FrErb*re>?IPn'vfh(cFoO#raDBCGT{tlLxSuK "E ܪYϴUs:%osB.#Yj0=s$@FVG=!P^MRYt%:VY1\u0>-#aX[>M(Uom&Ϋ /ew6M6;"׋iATQ/d_3w^fbc7&\Drv䞧B^F,_Aꬑ154cUS;YU.B!8lo,\k]ùla]0wFGaIZ`7(%FZ1{x,M‘ (nIJ0,8lrAu~`@Cgr4)?S++֚' ; `QMVU눾3`\|#=džQ*G̋d^W){ -ԃw.q"N,gP}r#H)* }MϓNT[k ]R3o][ ` dF:zn;k-_'dJR!u6Yq1_DFp"&p:'od2lJhhe?Hት[av߁L}Q}nGn?Y Ω"b CLT\A ǝg^ ZtPfd$N_`gֳtRGBu|]:yۑ ?gKʅNViKR]vM؝l^C(k8ޟHkGW;0k^?󆡴"Rimڮ4JUt[?eSS`:\Ƙ.z"㫒 59gY,d[2μ˜Qr&UrLy7#%'fy}-[F<Vxӭ^Y&`,NR!KSX QǤ3KGn UHȤ>jNԶuyV(be 9^+'?Z(U.8Մ`#LdRm)=(tFv:]^D&$NI%'qRc2,9 Bn196XVN~r|}.\HVUyƐ*kwEkdf'@\~Ë,8Gdq@βRPzއ?kt&D5]k:E ޲B`<#O)nM@+'vym3-LH,0O; D̆ؿVnSsƷ19'T8G/[ 2!yD +Bĸ cX V`mޭFyUiMp8MV]<[oTaօ2cٝ+xȱ7bU٩׭ w_6&o~lv4Z nc]>U䳸 "}]sp޸*NDW@ 9E˻r؀R-?K5⣶ E^ǼFSv3E,R$BY@Ra,9bc9[.)FdkvNbaaj@G3! GNV>`Ҏy^,.>"> EȂc!5oj4(mP4mni  +p7p=^a/Q\+ڗ[zba]-"O*@b9#uUv[ւk;yx;T"  x*s5(03Iɩa |V[SMYoSi:-#3,d0JV|b-v7Vx|}p+F n8^aۚ繗q  _0䕁mҍfނJwGI^R<3? 01*3AbIv#?oWdC}-v a脦 d0PQӸߤ__O' -S 4j9&zTx:7*](ɲ  G_H]~1BW1^N59_$'شGyloI|\*ں,CQLΨ v ;V Co"H%RxC+='lYPṻ\`,ڧ%pm jUONkQH|r^gyBrzdBAIR'727e4?!?e(I{׋\seW)LNR&>Lu?AK*Z^/H?Vb?I.%>,ґ"e#u]W]oJ&64hJ÷hY75eU]$>d_?vCFwz@{#XB_?A{i,Ŀ v(jv1 uTUp|F*V 4X?՘}Jq6jDQ &`r7$6iwS8݋mF0g` UqgX6*clPϭ 0Seqh>3$PJ{*cm-y%9rJ!*>Mݚ-E/S9Z\WWzҘ'^[r2LOdV5;C#) 987\)H] ZHB/<~0'8 RhJѾ ) h*^NYȎ6pȎSזe =2Ƀr1ԑ'`q<ZDҫI[oIM!b.ֻ-{hr}^wDXֲaduƙ<AnRv$~$? YwE?LٔeCKP67#tȍG²Ay<cO~p_Lj:"o^Ep?6[sAH9@} m|LpT--}N #va2؇ (: 6=+7V;[}ńQiʬC1Rbɜgd\&Ҩ]OIVfzmT`c+Y6<' A~(%ѱ2.w1&:WPv€y%IUݒe'wt9r#x BajycZqN8i89 &B{B»VɊU)hzh/Qn@AXb:^ !iM֣a!2 1l@ڼ>?9 y0QoWN15>L8ܻ*H7Sޝe4zr@#!RZ}XJ@kպhF=ñk+P]&_\n-$B\'c\KlGc @٠˳ C5_):z]|˚/tu٣W/h9Ǐd_(K5#e`/c2`eIO')Ҭ ^Ud o$$c >/w)<CnE%Zs|]XDmxwiCrToR$!tؘo ww{DjH'$En3f_|<ޚ#`Z-Bx qDm-mF}=r $6yIDK#Qf /u:΍׉}R E2a0G]Asf"ㅚҽ1T(Z,3"lo< qA_:)E& _gچX3mGoz=%[NYlU{{dɮHD){$H~ )}:gCREon%v\(].:AgX)=g(-O쮴ip훭9FZ~<[1];2_m lP^nrFMSGt)m.OjjiT]'߰$,n)>1sQD @P2t]1- vʷڴJ9wT裺27%k2* \0o$,)ޯ\! ҢзQL_Pڍ7A 3ntkn¦ %^}o-\ BSx0'W\e|?A9B: <- @<ٵŴ!-/  \zھ->ANcG`۩k_ i"r' -LL]WZ[sUTRbaiA-Z{Lh#(=M!$)cw<(PQ%T]N%3fm;u^4WQLB"H 'ɍч?Lk`(wuǟ3hjwLo}0K}"TBbA F16Yay UtE)1Z)P-26|8Z4c/|(q|mBIn*q^0rs^󗥿IϏLؚȮ3Pe 6xqܕ֪b|GC}W#R:i\-d$i1btؿ鳀(sRX} #^j ѴO$4"xg260[J. N5@*%a3'Hj-`>q/Dġ_֩V6" ն&IӶV*mڱG-q%3q,0"Ckt"`p^f"Lg$P"%\)0WcՉ`K!=玲Aagpy!°lTW)\ѝ աCERlFrʎ r(`Tlsyπڗng#^C&qr+c.C.8bڟ$tG n|!BL$겲{0A c0&Y8gcэ6߮ty`qxF,4AC(L-OX",u~6Eł4NCM), 81Us7/-s6نr/&Dmn1'@XaWGJ74%cj@Ķ0u;KR? ="&t xfq+ 9])[gY|:'a4^1 vy [C0YČkz c.(W#z$MaJO!2̘ܘkdÜ?-$TLƐHt;yS .倆(! ~(v)*۟=~&yOaG^ֈ`2/,:fD~*}`q~U XpV9Vᾣ1_ Dj6-02+{HT`p B%*%'Fՙ!pԁ_)I@}!z{WH|K ENz,* j`Z5@Hd?{o^"ۃc-DpWH(_;h>;KEpɕ o2{Js~Uu :]Z dB5L+ɰ0SZ|"2Yj\|P@^8O:q?&zgFe \Elkq@J!%v˨? 7KjT~zp4Ӕ|a'X\ avY4 mIoT8HLEW8Ѵ?MABvMWj++܏\: r ל.ᠫx_G<8܋ 2?IJ褛&?TyQN~Ai x3QmL^䬶."hMh8g4'?KgXN`g15o TGSӆ(7X#yxY}[{uŏ,1 :uVqYbz4F$HF iv7HNbȀ>o*,eICK|KSf@tJ [>Ѿ__Ԋ$>3K7L\}1$å|K5?XQs[y қGBn\@?]䀣s(> #ƒ&ruB&B$i&t{G+U:Z5dDZ!{} 9 L$3Ԥ$. +VB5V\qaVu=> v)MR5\F70({eQqMyНb8_4Z`$N4O-ke(b[ASk *>K:l:\jž_+w@ZjD"S=LѮW ;V5`+݈k-% phNj@ߜhJpa⠏5^ۣMF=<+`1l\iɒy=/Y Y 3 5qVˣn*ûā `mAeNg՛̓WF'hjd.n ;v *Od GE*>`3M_tTD{ⵄ5Q}= 1XFzުr7-l^vNkgRRƇاGK=IG+ W$)%e AR'9_hl(b,N!ܲ ]Qi/GHʝELXɺ󳍈D?d[qńɿŜNN\ EH={pC D=%t(8g~i9~꣖," 89 wzbWCUCt;HkV.КQB8wX1~4ՋqYJ$M{԰PwՇN\zjw{[h鹐W  ܔ1MSD` * {KiFD(+,VP"ы,m+e `Zo#H1M_AJkN#'rM0N;ግQTAOdWa 7X_ KQ|: @lVFDi>CV0*# Pk"=_z s(;)\޼J=aq4>~$_;Mc&f~)w&uBP RJJXէa`B+ΪbDp_;D6#R `u~Y ֫b~߭r[.%p !IxK2 oEI!aHk~'#>lV04I5?W!˞aT%d" Y]"[J"&%94DYk,2\1cKNc CV D4xmKr,֊f4Bz]B _Q ,r5V3@Br( R7f2f%N 0-p 1\.ׄ=3 ܘJcGrw]tEZkP3 8? ÌMS4{p4^-`i5HE*^t%:3ξqᯐ̟#3}kbܺ'X9 }JƳEyf[7kj5#vor0ڍkX;)Y#czҶAKH?p$@WHp.txX_&!Թ.eO=\F?!C^O-!geL]q73\RC< va_xp-pyzj6Q4I9}AN s:潱M~1rH 68m\$Mu;h7+MYI.oÍt#b]洂Kj!R!44k RH)Lu$R G~dH>>?_7a+ W~,#\:-lY>2[r'Ӊ'/c0im=02,Mf8=ÌZW`堒ζS2wx_l4} s;;ujsUg DZw:yҼ" !۷-=)Lzv|X)Jrqa!rpXf $p* X:S"[AoSKy ST7+? oBYIYo,4hYa3ҫ,ZL<)VHoF )a"n^j_~͑5nJ8a'wB8vhzGT1ȃ%P޸/+x ѯ|{AF Y UTH aCn0kjZ\l7cx+Fk>U6 "-Yw|>tT/u"4j'Ʊh}l)۝ыVVbc=d-}+x@ǁOfaP)+T |[कrQϫEe6s~8 $XCklH DB$":}4h觮ã70[X)8_~GŽl2i%Uֱn{Wk N}}{g И(؟cC^K V,{Iڃ$3}ΩI6]yrvuV{9MFb'TCn.mÿ:el8hb>qyD]pV"ڞj:~jR9m6euF94|#DrFR-WOCcMʼoaF3n#}S%e{%PXN+g0T {RzyxJ̿;n)ԵtoyYm>$djfC |C`R/ql XnJˁO&Uٽ:i>D@'&\"`\hjUƉj\Α*F^ ty 83#OL5 mvXz#%jlp7~-ȁY}x7K`e*P2(f@(s-a!wL ]-)`F?"6x&.fK!׺|eA(Y1 \UZ['u .b':Vw' Lhey6ʜ݈f=X4C A 2‘_n 1w̠\3by. B_m~kg|vAt&PSmMeK WCdYduwk) 2TpYuMŰ^4$M^hd'7o4B+5xX5Ey X"mZiInl7?2ض#O9uzy?.9xvGuaYkLnv ,b@8x8K>uUI` +3wiWǦCC8HDѩep>L6NihF0 u ɤU-dY*=b0>J_uOt,Mq^`Ι{$3tpbffl m],-: " ~KRW I;_!3}VG<z,mW Ζ>0di(V7Cܷ"Nu!bD'RwD>*.ZGd`4{lW+b6;+~L?ӌPAd|y0eQYz$U{]cGb$׮XGl+_ #rZeNXcSJ ?DOƹ`-e-QS%ȑc`Nc\P1Tu_kP\a,r*/2Dc,p8M%\zDܟS#OX}U_4+-4qnaGM ҇KBZ"3\eWsg}b -lzn_d?)/H9N?TmXi 4,#npdr]&B qɝ&U`w*2!.'Mt >q`w${Μ>Z f?bx 'n3Zf{QPf&<_hjc.Gs/tJn9O1?1sMGa=G`2:j@kbV$_丆uʗTu!涓NK-l:I%4E`N0/McMi>N&wF|%{ƒ#_0pC7WyGm(_ȱܥQԼT ˤ5 P?{[k|^ *,8fAE.$ek+Az;p$pY0t,Km0wzJm1C;detU?k1ѬEz|ę}vb9(q]#uMH_iZ=3ܡaSo LV[ɐt8S0X+.#/pS>Up_ZᶅyR%.īk-9w1:SZ ޅJR b1m0(VTlG*\Y77B^\+|j}ʼחӄݵ\뷔foJ!UUp-~}qy? f3 Z\: K5I/Bu-'8U`5 u@%*)r>c @#D*hn @i\Yew*{3} w`꜕o IUTSYBū᡹n*eY.>O hMr@.E{BI[<2J_&SdX)5#SBݔGKe C>#Ea|ﴐ Cѿ&OKc\W |WۂzύU9h=ylUk3Ŝ!r&3AahF' pjq .p4Gb3/}`M HCH|3@ȿ^a#l\//xJt 2T,eRW ;=h^[MT2M R3)t 4%t0o."0b>Ȼ9LSq]I z?zX=$︥IV86AQIKG񔘴!r5D%!t{J=(pK6b"/)k:cG= 8njDG hCbd j\Z-BA 6VCbZRJSߧ8QXf,vcͺ~ޢ2T^\eW"@Vuv(U؊|FvUŎZ%?j9RSf.Dbv ,ߢ 0iL^m0d'cP~8` هW8,"F3 Ct5@ %90 5ͮ^W.4|yhwH* /MhS"Tj9;d*:Siˊ8gS9֓JUJ }Éb ?*q (89KC?*rԤN,!n$̠ns$fRLN,V ;HA$+)ǑJ_)N[zt#t]y^@ %z1!)_CF j)?FNGP$}>H Eh=! pA(ey f |WB#9;#wh~zDi>DrNd-a GH9^F +A{]xm(P,/&f~"AW؛XТ [./2KrsU4iUCck} ?HN2ർ s%OxtӅnx6K8-3J Sf; *9䰅GYdD8Kg~nq$8 72{K{,c_ԏ) &$4LSZ88zʼLU iؐ7NCϤMm^?y/X`E쩯kwd#hwo@cTyԢd3[jvnK!o:xU鈸m-% 1̸? ۃOr6=0Acذ]x h:z}nVC$S?ONGmp P# 8jyM;gP*6$@q^i~a8sW~ˉ@,Gwέޕ7.˦|nu•@ Sܮ`Ny옅[lHd4SdiXt`g%(8%2ЪO$Ǎt5]N٫ݔ:"$X@Cܵr܍*r)/V2[3yRKd?~qj*Uy_ueQ5h)^El7reuh >:\ޔj }H?O{wP8<_H)?^z35]\SA7!`u[l$z)Ѻb,v-6dNf)s NøݝFtmh.C W%r1#~<(0_e>d V<[H^22_OjkX63oPV/Tg7Fΰ" NCp &O1:K7d^BvKEՙwtŏ) "0d,-5vBʾW@T~9m}O |w3v89V/鉲aUFh6g0E¨'oH$<|K[mrC@']|.Č>#)cǁݿN'ŶE-% ޟjj? H@U0WЌxGU+ۇ%nKy:2 ?F`]>&v>HpNإ* G_¹WRfq:n63 muiFfU$u ZYƾ9 Q]W D D_Q7JO,vO;H8c*Q(ZMxirp`yו\ls5@J0>Q/ W?f]qF_"H (놳 @xpѐ2U}o Rp`yw8Tvp$g %ډZ}()// p<ו7-HPVgu.aiv4si@<=Kq(9|D%T&H;&.]f-Fe SK_-K<.H33݁e8.j!Y(+K^1Uc*WKQMiZHZDži;ƛ^/Ep r~~ah28mpm孷Ҽ6j?H6UgLK9 ).X&ˮLÛv`5kYynÝ-<i5rL+̾]Q վ2/154z#-Z|pj }%bEX5yd(gJ~7v䫈YH8Xj e%?0s},FPJ<`>7lpd?IpܨsJV}w^݊wfH0S9K`>8E*ff%W!C@oYUp:BGKCd%6a~pe  2휷ɿ3tofbBS Z7R0*O! ±)Z,jvΈ67s J߰ i ayUˠE؆*z:(| ]8l[l*\m\őERj"U;npv#G];x k;ն`ҫyG|rZ9;7t:K9dCa*@c|kI\/#vH*4B$/ Dc'tEA=s$! 5v,ҧB`9yHg2 xٻhj&聾˧PCa:26FcWan€fXWnw^D=]&Uag'UEފ_J^)(dw 8eiDq 1@[u_A'>wj.T+㼫W<]Uc(u𒦎XUS;s)RF~iZIz`N,x`ֆ&F(2'a!9#(@YKI.%3+GG-{{ou]H9Vs|LIRh.-ѿ.)\ \Wrպec}2y'B{l#_ʵ:F5f` )P7MhqV/(u%H ^ps'5T׀aZVѻLcJ)~T0c(rkݟu0N,:{`*y*ǟc_N7%(ESԴIE垦Dßt))2HGF&82JΨߟ^~p3X8O&GvJc󫞻V3p)&ӝn3[;jR3)rcx/4v< f%t:z(Μgo.0+ r#B BP On?ďÿ >K;ZiC7}g'y`HF _'#EJp,:~d* R(š[6SoV vP5QtAr@֑dI}\Fߩ8z^"dVF(NsoZ9NZC@0+Tӓ?)iO)H^y+5WBҚZeRrk"p?{'S8HX,DҏJ*+1RR-7'(X|ԯ]XhDKt9cEVq%BȤ'y'lBJ/EFތ4uۆV;v⦣,t6GN\xVgYS]S)^ RjI[7XPFeyvwoQvzxOE ?@6Fdb w&Ț(b@-6:&es ҇&ߠ,vm;To/}KO'Hdm%6!QdY={U>R6ӻH]V2okӈw+l(8OZ&ls;~6`դƫ&.;TnZenp}`6 #Dߚ8j4D dGCEcooH3]ѬZGFw<ÒVQ~g >B=~١f?YA>tEs{-]i'lmV!s v(Cw#Gä0c&\,BgŽsڵZW9*PbF;osJ;lG9hϺ܆ÆZ+}F.XFڭ B#3_CkaSpyu ʕ&]7PX5&7[[O6]].$8V5Fq{B/Έ P>k p4V)gH;.6 FEk˶@ 6ԉyT-.HV_£9jrvb]cw+$Ŵm9x׎Aj/|vb.Ù;򖛼 lEFhÚp(Sy=8 tKjf$ oyMx:ɧ#(-qCnnW3-eg} .;6rE>}BӕJ8zEGe %e O< |{O#cTU-4I5?uW5*:@F;:𬭎 =[OjBcsDmjR22O(/HV Jdr!KhŤ/zSe7y3B JdMwk<~o΁T)F\^2@fM1b"T-id&֟ah"5-Z-zwk5 Lң7xoƿlJ77Q%Δ"$%Xq\2wm&s΁|{#`l~WciYh>V8Cb{FpA0mL]y d7$M'\3s^z̫XƌȸQkC'ƍ0}"ל) V<ʘER('JJ^dÇuXh_Ʃ+ i8;dӓPdm8YԵ66$ؠUTD O*Ӟz"ujP=_';+K{h -!x +&[W*0c˳0D>)!aJcdzft u[svM/:B9^$ܬ+kulx 2 '@$4&#bڊP'qW8Nz)&5uSG淴zZ!g|́{de)FG$NCIZ,Y5s#f!PXc0}j lOJ`CIM)؊NSk\> q7*89yn ](J1[̫CY -գh/O|ZIqXBC>|8r;YDiTϊ㻣]F>#0ltn1= &}c%$Hviו۲[w\"թ5JJe>=΀dYEB` yxPJ]C N焌&ז|~5;+hqEYl )A1{yr"_hYgͽ,{۴\@(|[fYysUg߂MJ:#~7[%8v=y`5hoɇND _BǦ(v`4v(ȷrtcVgxԤ^0,ԃ٘M)8m~,Db(KEM#38u?f;vsmzu*7G3|x;d7 h׏2W$B_u4:<4XȼʂPڷVs~E ZAYG epTWǮ{ HEq?=r9-ٜoTv hwȭZK eSB[E:EVkm ?w>4ԫZK7>QQ]:_-|ƍae !Ur3Q#F 3#O8>х`q:;:$f_~rƠQK ұf`uJ;9t\o~f1PmU]NQtg}tM㋗ʗdXj5)%Zh"`v,cGk-_XH:1#G^108.0-sO@uk H>1=޵5|VNMLn>9vA4eњH'rj8fagoÏل[cSČSZnou>V]8"H't5y`Rq)\/u>^HQ}gU9fү\ћQKuz4‡ 0}% cDAB Ϗ1@djc;4 UN;܂;,zC_uzF-G#x,Cc0s;/ՓXo$J̸br(H=7=Cl+:20URyZd?^NL@kb |g*CX3MyʨI ;0we&3BN@'V_?UuZۘx޳07ZK-y{Af[R2BR*Cx MϾ5!̣V?U'ݵ5pPXt2ǖկ%s[SO%̊@*WzVx(4 `_!dV+Vh3hdS{r* [bYki& PQM3_UbYQw7)oq_8,:[d" aJIt\pa^rٕwVնuIE}k<+\ }- gx#1dlg|O:ⵟA JuDZ-JS {Y_ZA%9,Ǽ1bޔC}+ aF<*#f뉼D0PȨڋlpvXrc]yӆYCQ NuDƄUs(-^dt*CF~&IsF^b+~,5Dngaբ($73c n!"WBwTG:k^nj"JY+8m.TUx֒Oaɞӟ`b[:2E`O* Ԑ58m79! cDt? ȺO[\l;I;vZWzFEf^b;%Zw җ EyVuMh6#GQH%^a -RQC87~c*VpJp.Va9YnKCMS `a#&COkax^µdR2cV>F/kT98o!O4 _lnHWrΔqȯVu[Y^R [gW@vB D2os 0Ni{VDH@MPb`\QGO\A|GQ>4 V}Υȟm`#)5Ӕ-^/0/fud CMS_esGx /VRn7T9\R]L#fݤ\@$250;c{7ƈ^=|oxiTLgEt rO2?kIcn{H ;&Kב1ުKZ.9jo<9b #pI#ݡ҇U+d)FYpΙӯu(Y;-H[eaK{2=Hڗ>$FYy_K5FJɛc"+L?|LEyȃl"QS_}ԙ":v#߻y91ˢ^q-qw&4Ǘ1q?~e!$u(38 LgQo,`#J][DH׭+HGȓ>S]+!29VQ I5)4wzuK1Jf?$hH&;RxǸ=(Bp}Chri{䄎y&(71HP<&,uy  -l]"_[`9+Τz/~{Z/Fyn Ye f~ .z↯Ɠ<A" ge6eZ/E%W u!=|MnH''i O4nmѥyqe~\2V kBO^PBkk6gXq=8 `S*'ToxC0rK}ËF;7W^՝b>jaQ{y$>E S{S y~7?VwR/.&/oTUx>b^[qEK> Ul GKzRKGQqXt{44#25WcٷRˑ$EA M-7ʃ0zw@ښGtʄoo,^Tj8s@swIJ8rrّ#L w-Q9,E0nAe=*p\r 4yY&^P?jף3 䨣PfT!]-4z*7VvJ)cenxO_eἘbQ|Q{qe@\@ʿ<;sdmuL8Ucv>1zv}=(uCyIxU)&_: ԣ92˚f_i; /’͂Saw"Iܢ%121*-USIXct -l۹fHc=W}GoWTlΏny}B.0aŷ3Hv~a'˄J<ݑ¿r-o3^N' Y@gbO*mzraqqUbpY=s5n{ShaXV +$E 2ҵ#;iK"Mv^[ p|qP?im5pQTWр;6bߪߟd鋷 ׸yZ+Q7Pv`T0#Hfֱ>lÉ蠈W?+2<90PwnS~])2O1FH3lljQZc_Ґ_#HTbޤ܋3L!sb7I.B)OIZj/344sؒd}P+PjlVj oP4/·[o Ra>/ZM5Ϭ"x+kn(6C޵zt^I{7Dً "V+ қ-ʗX ZǷ;n yכ3|yaTl>|03;Db Y|WW?TXiA,u|!OE1',Xn;TJcZlMJOB2XbսwG4z,@x|p|aC )C Cc-lI}Pb FJ4!8Unw._iHR"R\b׵yHAP _4&@bA*`ߙ , E3233&Q=c[-wy,KxiHT%+NȟQei. MAˉջGr;WimbCG^ PRdhetQЈ & $VuV+Έ=kzBG yp H Gp1:_Nг_판w&ЬA/8"j{ S{2ܫz]&Ϲi(#AaTBV)4M iCip[;)`px h P&z p)ê:W꯵SYr}mHM`U( +r"ʏA@0f{vÇ͖:Y"Lq 7"7x}4C&~Ca gN1@፰Av -crfxK{`MN/=x>?AJd čG {}^n3VĞ<qኙB:T/hFvofi.. %wY )3laz&8;c_1k,7V+R~'"dL4JsqУ}k"=Sbsqc;z T<CVBR,3o=\oó五5kv* em%W+=rJ/2/ w/ClzvD?%N, 6:Čv:9#kMd-Zµ܄M‘I2>%l4Cū%{$PN@Npx2m>uq,5bP:Cp1 H,H@Q#dyڧ]^Bl.zEUpc`X:+GNYXv723jJj,C&#šދaTj. j5,T@lZY]vEg`PR?o`7^}3SC`GU,gv$ vpq/ )[/Mi|"RpVl9VbވHJ4v"de-,u^Ho u^@ %4o;ɋw3=͖NoD"?|:DMTJ|~J@>i?~CšƤRKr&i w".{nx:hm(8G۵tj}iceAϡy-z#z[geO* @ٯ n7FLQ= ër21% Y` :ST["ݞ2 &몸#bfGk-U @ҁ % l Uγ/F4P۶8YS'O"Q1>u[oA}~xȎP68~ކQ-ҙCc;\7̈nl]ܒ,U ?\ϫ|ĸs:8J&>pͬ¯Rf!Ac4md%B=LJnq QEL N+F2:Bޞ,n0_jR;@beѕ ]VY3oKe/.m>d̩Þ}GNԲH:AX_'!52$Q(,ޭ}Ll韧y'mp[2]6y?N;m>oBK;{x+[wy58V^&cyC:ϲEXqМ,֣CH@zVIa *e"``ے__X)z9GI4UJ$+&'U-pt)Pry{ u,ȬHD{[3+ *5\)a+yb;7wk/MsuԶ\3h-?E=)Ւ@6 [!DJp`F "$ W s1O}:%m^TbĖ +&bp&xhMPRI<-}I+(lm*-nUժMk[ԆE8JL},wR'س/LLS42H9@?pϤԥpxG"n0&NgVnz柕T')Ȩ`BHgР;APf7BY (2)%\i=iu q#君kA:hl^D1ٜ +z"sw2 Ф̵Йҷ0 _ Obx #~^կcB۔U1kwRm#d(zڝ:݈ ѫ(e0rKNhBm n 3]/J*;kwKn}3?gLWrKJ•etZ4^}f݈ΫSs-зd2mP glt܌Q_Nao>gGPB\ȎX;>'-!Mƈu;j2&D@[:{)GU4]sdSJdwbK<>&dT:\'%|snz捪F~UC ]8jbҗ KTqO1򕌟=/4{SrqY‡h! zj[?e_4-J'vmTQg !] =C^ Iַ8۬&EKD:!aL!=o@"{p1{kkH2c1G)Qլqey(`ӰĈC]\0/(աRz|:IC5ٻ 1Y}I=H٩"1us4E)>7p:Il?fk*y1r73{^ Tz6>9"0[HY,vcH]|y0NyMj{w!<5.HވS;#fX1ZPFHuTdOwQ $d8 b/VE}Q6+\`sESc#1rhx𐮽uoZDk1XwP}blb=먮!d?{k\X*wMV^fM^|aӉFZg\G~X"T@hmiruOZ턺z&`/Ymݲ:''" G5Hf㌋ʮDl* ;TiMwG5.*u~j.MJR)?4`y'T9](I'G(#j;ΨO=P}OXG POHyo$PVtf)7Ɣ\eEaly:[%u̳j0%^[F#X\l,0w,pOhdX.6z@nvظoW\'e4K1pokQ_qN]C@!Qpe+|[Âz=d锎qzt\.Զ_ᘥǩ_vF? V'8zY e zW hȞ0ZԺ70}XiZs] .|ěWZ' à†SlqI8pPcOk(gU_}99ʣJO'"aI%޺=xzJ.=,Sq0ig;p=dS)E ΏCOjs7;(T!D{(k>4-ggyyU^aԬhccD8*&_i뱘0IuKtaZW=n[tJUF˞yFi%"99c]kG3MAKlQѧɞjEAK  Q|Wl2e(5 an9 V{㪒$MD Yb&xvTT*#_xn بuw[Gx5Z#N&]NH HYW4 y wMRs) x4G6N֪Y x Ԁ_b}aǜpÙS 00n0{_NG"~h!RyXlSDI\'3sni!ki5>y}e[N(P R];m5Le< %[yu=1Z>H)j6H\ShCq2#RQޞX~X`Z7!@_w(ŋM_-u5"g(XD S!;OC<{xI/o` A(?|]zlͅ~Mhvop(e t*.nS؀`:֧bdB^Sۮl˜MTg 4sad<R%?uC3N""9jin>.ρF;n t >$qkW'eSRTCD̰ {`:|4\yiMޘsq[TyHEVwͰ=9"*%;KMг6pܣ_#4A[!lV*%vY/dó$`UTƦuj>j_B?J~܃3 o j#hw|,D4,lud-aь}3j>Mddr!YV|+Gˌ&Sfm&"9B/ a=,Mxڸ(2PhEuH?:َ,ԎB@e0G(9OۺNsw@ {щ7!w ?L#`^8!6äٲHGRh,d*,=eh SPB"[֮_SBA/-!v/u),#y3 c惻mO6@z^u'fN?8(ԑmCM+y5Cܗ9x19uΚrN$C$oS@4fᬎ+^ķc}/MyD 8+!6Eja!:fnŹyX.6.Ͼ`W]8OIUG9fqFC2{xI'EW5;I%hfdӶk (c|TZEw?䚳@}.quOz'V;{+>eOUI>D㱄}^I~ ĜX 8\y=_ kU[{.iK oĪ'jmz+YbЖM$vU /^tU?Ԏoc6e핧 _S'`)Dnp[ż2LIsGks"me7u0lxQ թߗ{W̥߷jx-b+q!atE#I5duB8$ [OJN1b[T,\N3X y;s (3GX\ ~`B 9zٝ#oQdyKBik<#n5]I{8p푐$U Q.8qW4r# V9Q9+8]SWE{;6c ƓtȄAS7%ܒsb}٤ ) naxucĩ>f]R-d6i∄t4Sw_lY/ Q^ui4E6R6z{OFzu3xA`fSJ$gk%T[b*KgAK.$ mlζ˼3!C硦r9F=IL/I;* yT73*"¼QF$6,u_0X4r%' 7wed  r C|p~P޹$##)\E̓5lD 7QߤP2QH\5ӝJ@`&!q9䉫1\v_\dNܬB/~U|sMHYxe\]JU+w%.iL..vLry݇Z2ܾܺ0}HF#%iuQZ[dQ .@x%e:#L|çM~rH#i˄.A'24Dog;X Y;7pPW= V2o~\1 +%euzGRAȄ6dynh!XG||9*x!Q_Ԯ;h]Lٍ!ֶLjDd+63"቟Rլ=4b5 iRQwBH?(*࿴H9.5& fuE|6Hsn?gΐݭ#XN((vXpM>^1u (V$K~=J7uC󄊤.(T=JF>:v%IG¥ReuEz9U]Lu6PPC˟=1hbZm_&#]m2j*/MV%6;Rsh`I5F" w6!=0k85Sq ׁk/cR*tҀ ̄w"c'eb1,"'w%/㾧 |g~dWvM$p<Ĩ&,AoaWwI2D~|9%:Jqcl;1ٱ_[fWWgd UMսX!Au:$CZ쳬.@(5UegV a_R[G G(4KX1UiYaZ閄amF}dk/Tf#/7ҕXƚ y[8b;NM×?l!A^?읪q@uUևogYfmV.%cڈ7EWnR\_ہO"M *df'UjkA6*M?pbB CŖNl5_!~Ofb9jگr@Za]r;שAL"gzn!ḱ(Knw:a\ BuD1i-Im˾?4e݃9lvk!Q]'Q+\)TLwʜ3U9U~L#Tm9!>ZX0E%ah!Z&n 2as*ϖEA\"8o᤮$>ar,@/A2)MEE~N D,]Zf¢-9]u=vbBLlwfR:2RL!ֳ\2L]jg#f U\ Lja׭gdmZ4o`8f"Jb44^A[ԝ#`7""AU Vm9jv:>w_e_Uh D(v^rR(cNRDjG 4rC ]DNKI7C)44L dAoJA ݘRG`XYO}Ό 81beNQքWhJ*+~LƞZ@MvDI]Na/ Zp6aƎ U,c4C'KDmȻ8[n#3P\[Ј$)L1ix#;3!I66j/\i1Hۛ`NidB2pvnv۸8]^}hsF F%f"#"8N0f^du[Cdǂ))nfyh;\-߻ ΋⬁9p)}4A$GM8T=!XҏEh\ b& JҰ?moNkrVUؒQ[(6>ZHp)!tYzL{zEz?>ájX3?!" .z{謹%H扤hWL7kxBLXhz]b 83h9(&V8Xo 6K’p;nݫsHZj$2.fGIV Ǣ`)2;?%|6&l8 ,tfC"I"(̻rn' MGюT5m#Έ&rJYaV 6JwǢ_9&eL|."!oC5'ÁBSK\4r쀲(J@~'4P7Jcmy\uW.x|G#D piG̱&9mLYj$I0w,Gf ?\GUaGӕj1ݖ/45 cç07Қ څyI5ׯ:Ka˽>Pynp [wd [T%X&*J,B1gi/VM~P$ 7x$ꚨaisB@<0ߴί7;ØqEbQv Ld]S "X=C_FŸe@&8iy]R'^^i$e^c!lbKSC4W-0fLM 02T{4"Jo+ZW'` ~q4*1B6[ XiotP.I ba(D\K`mʟ c{!;X-I{ҍd2:WSa8u,>Ve;9eÖ9ţ]YPYƝJ#͊Î4AY^[`54wdp)`tN6a:}-K+DcY+98طQlGJ} ~vM+\gs*$*qҝN=z^ckL 2,lDZ#ԝ2r^|!O K+/@Zl^v"Ո=$'қD"&ݜ{fJ p|Ǻ#@߯8HC4&9/.8%W,ix,-py?gJԈH0 ~=M8no%\ UDѪX7%d?*q9;deWVE6f,b (b ` $e PI3sÏthv\S=BH#d/u`{1lKUP]Yòw-s8;YM,e$sPYn[x4M.Zե2t!?dwV9|@^USH担q87FQC/TM@w4OAmʌ+IL &/@*!O$d1yl[1Ø"jzKf϶˭Vk0Ws:3ƀ9khSIR-U(g=Wk"X5j-1aV]_g=%}dCl9~0Z|pnER e)9(x+mMfc*W+bN Oo@4E"tPOjВ~~a_/A"*CPY`޴+Qd; Y~GC&^UNj.I5ɝh wn}gx*e=p&NDdn2@ߵg6> t,v" _LR(;d]DؒDŽFN~"guS.GLbfA͏P9H$vHCSQ/J~Ah^="'ᗜF/ĝZc40?9]߳g/>ճuKy&="0 Z+Jٝԣa 3J1)jE/e܄!叭 &-b+̺\N>!% +A=@տv3@4cDTe]t܉_mKeR)vZОV,WP%k7'FfZ'vJ8jMf]~,ֆ0>oeX>6tgA/MCwr1T(j~Yb_uul%=fl'ӿlg Y' }iė rQN14#3ŊjAKJ XXYCzOiS/3Jw 5l(+^zezPRtp+kE.c\MUWSGվ7JC IR]Р&%5pmD1AtȳQ)/uSFkP$Of8sRS9C|D}|鏬.8 g)3TT F؟j;[Zm31Nm^}}b\䖨T !}HN-nPus*\ ،0DY-&҈Jc7|=C~E(Q6huq!VyΘ@HUňʰp}k / "\L a  Jy148tGVt*D&\AU,q_^R=%:M"DS15Y<$}SfN,%@`.O6I " V.oJrj'wPڮ' $5WbDS)v=!zwPlWX àr=C@wo5fR^ě!|t0PV jjb?0sTc|ߣPbdL6 }/*eEJM"KcA[er@V,ci*+pJ\0 !aLfRH2pg9n 7RrhV15tq!̧LZSHPZ6Qɻd𛌶n2ԦZ:Q1Ae`esB3VVX}Ϩ<3Hih9!?G&E}m30sXcArrCSgw"2/t?Bi(₽۫Iء*$FG%>`_1G cpӪQL꫉UKy{uRӭ@7j}y`|5{VVMIJK}p*3Bb0649mF0UT̈́VWX߬:(IOӈ<Nk-<'ytYM\:FdUB7bz^2"G>)SJ'~*UƂ}KDk$&!]@~! G LOS77hR󶠙=c(J©k+ or%ÙM£/Ofھ,ے/,Fmpz8wOTZ-r$ΏWĂ~x:άF ┪jsHjae;XNRcS7zxV}o0=ӫInî. >]cC1lFqЎ.s P}X߯VYV'͆xd*lYbBÍ0'YvK&{etʠ[)k&j߿K)3$[f$H~ˬ#[ȭWlTAs1<" ]~l zl[ ֓` > yE2?ɛd)YdٹCÈYlI(e%yRpaqI IePAwƭ&K-?L ;,K|衁Eʝ2E!Bo!TX.ĎhmU'p rEEWaN[r9$q >y:L:~h|w6q OwjŽv[젹#6p5._:p &ȷdV[lVsFT"o S,6吷-0kzQh~ :bJC-͉T!*ړtjv$.sCeaYkʠ|QEYw4avӹI4-S^.RRՎW?]op!"G Cγ&7l7]H 2raoN)3}eUT`=;A׌B?tOW:ǙUӁX`WE/i~}=C1T2`8INew":~mϟ@ [s[oanWln i%(Y~$~Z1#8Eg:"Cq`aX0I1HpڮW˅})B,h]U(ٴ[fK{Tο0gOa|I0R(ĦSI`(wrO(>q<7hG7ӣu%᭿+_HrlaW0eD1{b>Y*Xk mD"-\@8Rt*HhO{M!}O!8_`lakdh;Ͷ1+U5dGނ3 :[խaQܣr0& €ƚ=aClͣN<y]-[u\xNMF5h)8FsUڈq[ձUO4-:z v /(]#S$49m3"“gݒnWBߴ0p_3T}JBDEpUsak{γ0|ȟoۻdک4lԎHp@Xz%e k=2$RRRԍFc[@k2ؼ+n^bc1/ڵd{\> 6,#h?d&G@bb8/d6 3|QW|k]Y|']j*\$\OV\_x7`m+p{D+[',s|h}p˕6ΒgHeZbXyfux_cFVD{Қ~$Ob h!e#bV9Lκ^B›yJb+I< F`AU=_*BJo@IW\tEJ!'K/'#T+_?+0CJdAآWW #ޑ`ԛGᚎ_=B- 7p6 .uaP;Bg]P_tWEA[cӁWڠJCFgHJó;Yٲ$xBl,荑F)ڢJR4y6w6xs#$!sw` AhjؘtTdLEHHO~I\6 K , x4A.,T~c'8VBgKm%I6i։ZT$pkzYg@l-d^r-OޜP>Y`e]㆜ gКYSj= >;C+OqI=o׍ @Q37j= F++TX`cC9\I J'rb0dZ#}!1+=JAoW0kDkYލ'''ku;[J_8 Ey#q!*:lC >smC1("V`pvwm%% ACmaH-gbWy[~ݻayDw~ƠXQpY&[ZڄL|a)]DB]`/WyƋ13{zJ9_M#: a&EF9 z䑘>ojB0'0ٷ X6M6IV8-٭{7UHZ<| 8g}~0I`TGꈘ@':6 ÊFb.Ygw3{=1 %=B *.-bbb$zӔk'=x=$Z^qghCN{lRELb]o^ULk*epih*%˽\A%`JJA%q`s1þ*A +9,8?3XhF+tzYSc)M/kRag3MS a\nBv@j TZ{& Wc?L[ a !KxA(ItWSw -U03_>[H#db$Kڲ EN"![^ҍxZ}ODRSz I+*n3ѧ4dtn(2CLI#Aj\`lbėJqRy[]|bK:A6rfaT֚5F/3bA[VLzUI}AR~ppJ>57e/!IM/CLa6:vu V$’Jn /Ȋ]=E訖B8gݚ\"oA$;")AgB@LGph)A% S:1[V6qǩL(N+LrhnSP;+}nq#)5l|WԊ#NBcnda2' b3h6D&]cpz!8=ϐc!⢤aݰ^3|:ŷ5 WV(O@ߘOUS5(/ټ`+ b{X-q"5QGݪ iܼТm1b[4$W3*"vQV(&DCp$qUź_>{Ev%\'Sę=J buZ8Էy "Mhϲj-_!c^D Л/ c"G0 rwqvc59Iݷd?U$iH@M[BY|QxйSdJmݨm 3) ;'*|ƺJ}BF^@ZL$wL3͘:E^ &1! i6.Sʑ~в5XA!zpC^zh^1K;puмa~*zeGqح6q\( NS-aAh@o _d7~@>UޫҤTJژm#J,bM"?JlNlodiCM8iscY]027J1"Y>L;a25 kQ5uM0XXz$j`Mm7\AqҘAQkjuc7/P]$2.c  C%Ƶ02(џ]/Abf溲fUV:$ӎBBpM&E ?eB(nr*ؠpյO,赐Sr[|8ZL2O+5 xxZY]00ܡ0/\K6P_^#~;&Û}[-C''r\0F!^ uddGR+))Cu2A p\y1K[//T?K ^}Nx.٣5{J&@+ &{Pf,?G>1"K -zhlT`;8d~d)fFkkKDK}Y&>>D@`ӞR 1ڄBz46z9>5SGjk~ uOzP3{ FU6ۿ|YƂ4y(F:-Ψi/ #ZBcR?7ss.ڳ 2`5Z;ƜY JJhGp Fī*K13Rv] !Hwǧ1۽d.:5}?ƍʊ}4 ==+˔@2X6Xy6͑Vjv_!+!hN r:.m:|}yR0Syw܇}+iP1QDR<ŸFľt~Wc)2#_P]ܡyW& IaߙWIX1D_uצň۟2Q8$%ԺϻQbFJLWc-ŊFHKET˱?a^isQMMmD1f+y)sGv3njB4wEG`zB&-9s~2_~0Wl=Q@UJya)hvĄh-> Lj,ɴ _m͖K>„"(vH%̿~ zO\$tSkmUl ѥu^8&@qq4}N^08%{%Ѧظ@ҼRy7DԙhJQ-0#bb"ϟp5ǘDxжlh_V;)G#tiՃ<ĬxnMZsR#?di">zOMgpr3)PX/*g튬 +t\ 9usWS`00m%ߗ1<7)Q5Llƙ2{'MʒS>VMsv-]o6"YᲉa= ~ @˚^Z:Xk Cvg.dk73?|^EOX(oԁN_l=o)ZrГfP-= )mR풸ܰV04@ uYgYwsnW vdzϕ ?#܅?%gğ%o/b@ד<]cqiu[n#0V>C6 gX `kOh_`26v`ѱ+>^9MΫ]33Җ8c͜?=TqZ03caʢ\^\Ͷe'kD}Gߩ:߷͌2o(V8܀W)?_rߒa 4kn`(3!>!h>J R> ? 9];7["s?=76AAmh%zlDm->W y3&b[H:pzGGm<;Ko qK0J;j ^QXN= 9{ƷcFSuoKӓ~ TMѸɚ;x.džʙ@邩*?l=buBHwq&ґp'WwTZA3GqE&+qF4mM#I]TJG D̬&0]:x5B6n_[ڽcǿ4.n;E@.{T[ՄN0>MQN9$pw^ ׂ\% {a3KOmtڟ)#yLu?"Χ ?|gֳfɰFNipOr^c挽[ala+~V|OO0.C,Zvy~\t?C T#Q1Td];좳y-ĹGqH™Hw FζSF[/~]iGS>GxSFe Šv?gʹk#Fܲ?J^Vp=KQ,Z>R+mҞp jJZjR`.wg;ëewfwxKMON:AwuljnU1HMb1KQW;L*/$@0iqbXK-Ƥqv!ɑy_H{O1@چ"JR<|='_de< RwLw_Ox鶊6K>WP. osyqCB`p1˙Q*u*4g06)#5^Y X*ݚAK rY[B,3 [7QY꺂H8viR{-έ萄 DZ$":$lD4Oϰ~!۞p&px/ǔegzԫťI։귪J:\YB9{%Ⴋ;NQco(03qh մnW+EVmʇ92cI+I$ma3S뾪X̎n0`c̾-5iNs!+h]("9H)R))0_OKcν#hFu =[h:קGCmm Uv4|.ːB_` 5tfsJ饮s)˹\^}+qR*P(VKÔX PiȨ !,l,+FFG7=dmhie1w@i&~ѝC}"D)CSH\sӮ70lor)@. L=0BfF!`BQVJpWKMǍ_f9o6*Af^qN3z.80sOi̵䇆iԊ6*T B<LJd;V̊Rơ׶\W15TpJ~܈V7>N/B !-O_ [[kJO ?B20ð78_[ t ӳR$_" YGX rѹ܂!ؿ~Q8ܝMy3^ =g; o[9.B`;$8Oj!osoV26hn[]JTC yaq I:{*|Z2l^0—y7+%/ÐZpXA&,x԰KWtQZF"̓G=59K~KSf >Bjr56d8K~ԩ:b}n+Atw4fڟi|L̏I%7,1a6_xa牎DW[? kUuTƞ5n[m$M~a5FAYE J+&0_>{[&/0(Xsa96 J?L iW`2)oBȮS " lN(Tv:c2"|`Iӗ{KI/rs5tWZrDU X0" \2AG [TӱtADr4l3D-5}D~2E3]9؛4 ph I8<azI%AԴ-lԧŎJ#PJFgר;q2*Sch.%~WV0 JZ Fo@*z=h=ޢ ͥqy3&%&1GVǵ':sw 9{xE(\Oڢ Rf'nVoX /#]x/ ad྘XHY&qi|XՇ䌸'iD9>e̪ 1@쬧eVZAmꁴBhs[p. üF}?\ QժEW}喋(~c?X6ǶK_W꿊B{ |֊OSt -ؼ/b VF#9e|ǀZOB @c&v8KEZ=Lu@ь1qG1HyhPG}f^ƄT;}ɯ@+9@{4m~w#Eå  Sw0# pfso߱#,?Nad?KM9sӃ1TvUA@Lnur,J$Mxdy1{__GRyg:qMO3d[xYy& d[9kHX